KEGG   Mycobacterium smegmatis JS623: Mycsm_00952Help
Entry
Mycsm_00952       CDS       T02423                                 

Definition
transcriptional regulator/sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycsm_00952
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycsm_00952
   00052 Galactose metabolism
    Mycsm_00952
   00500 Starch and sucrose metabolism
    Mycsm_00952
   00520 Amino sugar and nucleotide sugar metabolism
    Mycsm_00952
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mycsm_00952
   00524 Butirosin and neomycin biosynthesis
    Mycsm_00952
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mycsm_00952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971700..972602
Genome map
AA seq 300 aa AA seqDB search
MNLTLALDIGGTKIAAGLVDPEGTLVHQAKLPTPDGDAEAVWAVVDTLVTGALAQAGGQV
RGVGISSAGPIDLPTGTVSPINIIEWQRFPIVERVSTLTGVAVRLGGDGLCMALGERWRG
AGRGAQFLLGMVVSTGVGGGLVLDGAPYDGRTGNAGHVGHVVVDPDGGPCTCGGRGCVET
IAAGPRMAQWARENGWDAPQEADAKELADAANVGNTVALQAFRRGATAVAAMIASVGAVC
DLDLVVIGGGVAKSGALLFDPLREALASYARLDFIRDVRVLSAELGGDAGLVGAAALFDA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcacgcttgcgctcgacatcggcggcacgaagatcgccgcgggcctcgtcgac
cccgaggggactctggtgcatcaagccaagctgccaacgcccgacggtgacgccgaagca
gtctgggcggtcgtcgacacgttggtcaccggggccctcgcgcaggcaggcggccaagtg
cgtggcgtcggcatctcctcggcaggacctatcgacctgccgaccggaaccgtgagcccg
atcaacatcattgagtggcaacggtttccgatcgtcgaacgggtgtcgacactgaccggg
gtggccgtgcgtcttggcggcgacgggttgtgcatggcgttgggggagcggtggcgtggt
gcgggccgtggcgcccagtttctgctcggcatggtggtgtcgaccggtgtcggtggtggg
ctcgtgctcgacggggcgccctacgacgggcggacaggcaacgcagggcacgtcggccac
gtcgtcgtcgaccccgacggaggcccgtgcacgtgcggcggccgcggctgcgtcgaaacg
atcgccgccggaccgcggatggcgcagtgggcccgcgagaacggatgggacgccccgcag
gaggccgacgcgaaagagctggccgacgccgcgaacgtcggcaatacggttgcgctgcaa
gcatttcggcgcggcgcgaccgccgtggcggcgatgattgcgtcggtgggcgcggtgtgc
gacctcgacctcgtcgtcatcggcggcggcgtggccaaatccggtgcgctgctgtttgat
ccgctgcgcgaggcgctggcgtcctacgcgcggctcgacttcatccgtgacgtgcgggtc
ctgtcggcggaactcggcggcgacgcgggcctggtgggggcggcagctctcttcgacgcc
tga

DBGET integrated database retrieval system