KEGG   Mycobacterium smegmatis JS623: Mycsm_00965Help
Entry
Mycsm_00965       CDS       T02423                                 

Definition
(RefSeq) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Mycsm_00965
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycsm_00965
   00650 Butanoate metabolism
    Mycsm_00965
  Lipid metabolism
   00071 Fatty acid degradation
    Mycsm_00965
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycsm_00965
   00310 Lysine degradation
    Mycsm_00965
   00360 Phenylalanine metabolism
    Mycsm_00965
   00380 Tryptophan metabolism
    Mycsm_00965
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mycsm_00965
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mycsm_00965
   00281 Geraniol degradation
    Mycsm_00965
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycsm_00965
   00627 Aminobenzoate degradation
    Mycsm_00965
   00930 Caprolactam degradation
    Mycsm_00965
Enzymes [BR:msa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mycsm_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
993274..994212
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIIADTPLELSALVERADLDPNVH
VILVSGRGEGFCAGFDLSAYAEGSSSAGGGNPYKDTVLSGKTQAINHLPDQPWDPMIDYQ
MMSRFVRGFSSLLHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGMWAHRLGDQRAKRLLLTGDCITGAQAAEWGLAVEAPDPRDLDERTERLVERIAAVPV
NQLIMVKLAMNTALLQQGIATSRMVSTVFDGIARHTPEGHAFVAQSREHGFREAVRQRDE
PFGDYGRKASGV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgccatcaggcccgtggacttcgacaacttgaagacaatgacctatgaggtc
accgatcgggttgcgcgcatcaccttcaaccgtcctgaaaagggcaacgcgatcatcgca
gacaccccgctggaattgtcggcgctcgtcgagcgcgccgatctcgatcccaacgtgcac
gtgatcctggtttccggtcgcggcgaagggttttgtgccggtttcgatctcagcgcctac
gccgaggggtcgtcgtccgccggcggtggcaacccgtacaaggacaccgtgctctccggc
aagacgcaggccatcaaccatctgccggatcagccgtgggatccgatgatcgactaccag
atgatgagccgcttcgtccgcggcttctccagtctgctgcacgccgacaagccgacagtg
gtgaagatccacggctactgcgttgcgggcggcacggatatcgccctgcacgccgaccag
gtgatcgccgcggccgacgccaagatcggctacccgcccacccgagtctggggtgtgccg
gccgcggggatgtgggcgcatcgcctcggcgaccaacgcgccaaacgtcttctgctgacc
ggtgattgcatcaccggtgcgcaggccgccgagtgggggctcgcggttgaggcgccggac
ccgagggaccttgacgagcgcaccgagcgccttgtcgaacggatcgcggcggtgccggtc
aaccagctcatcatggtcaagctcgcgatgaacaccgcgttgttacagcagggcatcgcg
accagccgaatggtcagcacggtgttcgacggcatcgcacggcacacgcccgaggggcac
gcgttcgtcgcgcaatcgcgcgagcacgggttccgggaggcggtccgccagcgcgacgag
ccgttcggtgattacggccggaaggcgtccggagtctag

DBGET integrated database retrieval system