KEGG   Mycobacterium sp. JS623: Mycsm_01042Help
Entry
Mycsm_01042       CDS       T02423                                 

Definition
(GenBank) ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00051  Fructose and mannose metabolism
msa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mycsm_01042
Enzymes [BR:msa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mycsm_01042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGB21467
UniProt: L0IU30
Position
complement(1060410..1061066)
Genome map
AA seq 218 aa AA seqDB search
MRFVDNAADAVLAAAKDMLRRGLVEGTAGNISARREDGNLVITPSSVDYADMALDDLVVV
DPDGAVMEAKEGRSPSSEMKLHLSCYQAFDDIGSVIHSHPVWATMFAVAHQPIPAAVDEF
AVYCGGEIRCAEYAASGTPDVGTNAVKALEGRAAALIANHGLVAVGPRPDKVLHVTALVE
RTAQIVWGARALGGPVPIPDEVNRNFGAVYGYLRQNPM
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgtcgacaacgcggctgacgcggtgctggccgccgccaaggacatgttgcgc
cgcggccttgtcgagggcactgcgggcaatatctccgcccgccgggaggacggcaacctc
gtcatcaccccgtcgtcggtcgactacgccgacatggcgctggacgacctcgtcgtggtc
gaccccgacggggcagtgatggaggccaaggaaggccggtcgccgtcgtcagagatgaag
ctgcacctgtcgtgttatcaggcgttcgatgacatcggcagcgtgatccacagccatccg
gtgtgggccaccatgtttgccgttgcccaccagccgattccggccgccgtcgatgagttc
gcggtgtactgcggcggagagattcggtgcgcggagtatgcggcttctggaacgcccgat
gtcggcaccaacgcggtgaaggccttggagggccgcgcggcggcgttgatcgcgaaccac
ggcctggtcgcggtcggcccacggcccgacaaggtgctgcacgtcacggcgttagtggag
cggaccgcccaaatcgtctggggtgcacgggctctcggcggtccggtgccgattcccgac
gaggtcaaccggaacttcggcgcggtgtacggctacctccgtcagaacccgatgtaa

DBGET integrated database retrieval system