KEGG   Mycobacterium smegmatis JS623: Mycsm_01089Help
Entry
Mycsm_01089       CDS       T02423                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mycsm_01089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycsm_01089
  Lipid metabolism
   00071 Fatty acid degradation
    Mycsm_01089
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mycsm_01089
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_01089
   00626 Naphthalene degradation
    Mycsm_01089
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mycsm_01089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1104906..1105967
Genome map
AA seq 353 aa AA seqDB search
MTQTLGAHTASDVTESMRAAVVTEFGGPLQVEDLDLPTPGYGEALVKLETSGVCHTDLHA
AHGDWPVKPRPPFIPGHEGYGTVVAVGEGVDDLEVGDKVGNAWLWSACGTCEYCRTGWET
LCESQKNGGYSVNGSFGSYMLVNTAYAARIPENADPLEVAPILCAGVTVYKGLRVTDARP
GQWVAISGIGGLGHVAVQYARAMGLRVVAIDVDDSKLALATRLGAEVVVNARTSDVVAEV
QKATGGVHGVLVTAVHPQAFGEAIGLARRGGTIVFNGLPPGDFPAPIFDIVLKGLTIRGS
IVGTRQDMAEALDFYARGLIHPTVQSARLDDINEVFGRMERGQIDGRVVIDYR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacccttggcgctcacacagcgtccgacgtcaccgagagcatgcgcgcagcc
gtcgtcaccgaattcggcggacccctacaggtcgaagacctcgacctgccaacgccgggc
tacggcgaggcattggtcaaactcgagacctccggtgtgtgccacaccgatctccatgcc
gcgcacggagattggcccgtcaagccgcgaccgccgttcatccccggccatgagggctac
ggcaccgtcgtggcagtcggcgagggcgtcgacgacctcgaggtcggcgacaaggttggc
aacgcctggctgtggtcggcgtgcggcacgtgcgagtactgccgcaccggctgggaaacc
ctctgcgagagccagaaaaacggcggctacagcgtcaacggcagtttcggcagctacatg
ttggtgaacaccgcctacgcggcacgcatccccgagaacgcagacccgctcgaggtcgcc
ccgatcctgtgcgcgggcgtcaccgtctacaagggcctcagggtgaccgacgctcggccc
ggacaatgggtggccatctccggcatcggcggactcggccacgtcgcggtgcagtacgcc
cgcgcgatgggactgcgcgtcgtcgcgatcgatgttgatgactccaaacttgccttggcc
acccgacttggcgcggaggtcgtcgtcaacgcccgcacctccgacgtcgtcgccgaagtg
cagaaggccacgggtggtgtgcacggggtgctcgtcacagcggtgcacccacaggcgttc
ggcgaggcgatcgggctggcgcggcgtggcggcacgatcgtgttcaacggccttccgccg
ggcgactttccggcgcccatcttcgacatcgtgctcaaaggtctgacgatccgcggttcg
atcgtcggcacccgccaggacatggccgaggcgctggacttctacgcccgtggcctgatc
catccgacggtgcaaagcgcgcgcctggacgacatcaatgaggtgttcggccgaatggaa
cgcggccaaatcgacgggcgtgtcgtcatcgactaccggtag

DBGET integrated database retrieval system