KEGG   Mycobacterium smegmatis JS623: Mycsm_01128Help
Entry
Mycsm_01128       CDS       T02423                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mycsm_01128
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Mycsm_01128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1141340..1143073
Genome map
AA seq 577 aa AA seqDB search
MKPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFNDEDFAKTSWNLRKFLWAPKL
GMYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADPQWKDITDWRSELMPHY
DQAKRMLGVVKNPTFTDADRIVKEVADEMGVGDTFVPTPVGVFFGPDGEKAPGKTVPDPY
FGGAGPARTGCIECGSCMTGCRYGAKNTLVKNYLGLAERAGAEVIPMTTVTAIEPQSDGS
WKVRSARTGLLPFKRRTYTASHVVLAAGTWGTQKLLFKMRDKGKLPRLSDKLGVLTRTNS
ESIVGAGRFTVSPDLDLTHGVAITSSIHPTSDTHVEPVRYGKGSNAMGLLQTLMTDGAGP
QGTDVPRWKQFIQQAGEDPRGMLRLLNPRRWSERTMIALVMQHLDNSITTFTERTRLGFR
RMTSKQGHGEPNPTWIPVGNEVTRRIAKKIDGVAGGTWGELFNIPLTAHFLGGAAIGNTP
EHGVIDPYHRVYGYPTLSVHDGASISANLGVNPSLSITAQAERAASLWPNKGQVDQRPAQ
GEAYKRLAPIPPEHPVVPADAPAALRPLPIEPVSSAG
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgactatgacgttctgatcattggttcggggttcgggggaagcgtcaccgcg
ctacggctcaccgagaagggctatcgcgtcggggtgctcgaggcgggccgacggttcaac
gacgaagacttcgcgaagacctcgtggaacctgcgcaagttcctatgggctccgaagctc
ggcatgtatggcattcaacgaattcacttgctgcgcaacgtcatgatcctcgcaggcgcc
ggggtgggcggcggttctctgaactacgccaacaccctgtacgtgccgccggaaccgttc
ttcgccgacccccagtggaaggacatcaccgactggcgtagcgagctgatgccgcattac
gaccaagccaagcgcatgctcggcgtggtcaagaacccgacgttcaccgacgccgatcgc
atcgtcaaagaggtcgccgacgaaatgggtgtcggcgacacgttcgtgccgacgccggtc
ggggtgttcttcggacccgacggcgaaaaggcgccgggcaagacggtgcccgatccatac
ttcggtggtgcaggccccgcgcgcaccggctgcatcgaatgcggctcctgcatgacgggg
tgccgctacggggccaagaacacactggtcaagaactacctcggccttgcggaaagggct
ggggcagaagtcattccgatgacgaccgtgaccgctatcgagccgcagtctgatgggtcc
tggaaggtccgcagcgccaggaccggcttgttgccgttcaaacggcgcacgtacaccgcc
tcgcatgtggtgctcgcggcggggacttggggcacgcagaagctgttgttcaagatgcgc
gacaagggcaagctgcccaggctctcggacaagctcggtgtgctcacccgaaccaactcg
gaatcgatcgtcggcgcaggccgcttcactgtgtcgcccgacctagatctcacgcacggc
gttgcgatcacctcgtcgatccatccgacgtcggatactcacgtcgagcctgtgcgatat
ggcaagggctccaacgcaatgggtctcttgcagaccctgatgaccgacggggccgggccg
cagggcaccgacgttccgcgctggaagcagttcatccagcaggccggcgaggatccccgg
ggcatgctccggttgctcaatccgcgccggtggagcgagcgcacgatgatcgcgttggtg
atgcagcatctggacaactcgatcacgacattcaccgagcgcacgaggctgggattccgg
cggatgaccagcaagcagggacacggcgaacccaaccccacctggattccggtgggcaac
gaggtcacgcgccggatcgccaagaagatcgacggcgtggccggtggcacctggggcgag
ctgttcaacatcccgctgaccgcgcacttcctcggtggggcggcgatcggcaacacgcct
gagcacggcgtgatcgacccctatcaccgggtgtacggctatccgacgctctcggtgcac
gatggtgcttcgatttcggcgaatcttggtgtgaatccgtcgctttcgatcaccgcgcag
gccgaacgggcagcgtcgctgtggccgaacaagggccaggtggaccaacggccggcgcag
ggtgaggcctacaagcggcttgcgccgattccgccggagcatccggtcgtgcccgccgac
gcacctgcggcgctgcggccgctgccgatcgaaccggtcagctcggccggctaa

DBGET integrated database retrieval system