KEGG   Mycobacterium smegmatis JS623: Mycsm_01204Help
Entry
Mycsm_01204       CDS       T02423                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycsm_01204
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycsm_01204
   00650 Butanoate metabolism
    Mycsm_01204
  Energy metabolism
   00190 Oxidative phosphorylation
    Mycsm_01204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1219821..1220294)
Genome map
AA seq 157 aa AA seqDB search
MTEAPWTPHHREGRLAPVQEKEHDRPASLDHPRAPRRPRGIPYFEKYAWLFMRFSGVALV
VLALGHLFIGLIWDNGVYRIDFNYVAERWASPFWQIWDMALLWLAMVHGANGMRTIIGDY
ARKNITKFYLNSLLLLVTGFTLVLGTYVLVTFDANVS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcgccgtggacaccccaccaccgcgagggccgactggcccccgttcaggaa
aaagaacacgaccgtccggccagcctggaccacccccgcgcgccgcgtcgccccaggggc
atcccgtacttcgagaagtacgcctggctgttcatgcggttctccggcgtcgccctggtt
gtgctcgccctcggccacctgttcatcgggctgatctgggacaacggcgtttaccgcatc
gacttcaactatgtggccgagcgctgggcgtcgccgttctggcagatctgggacatggcc
ctgctgtggctggcgatggtgcacggcgccaacggcatgcgcaccatcatcggtgactac
gcgcgcaagaacatcacgaagttctacctgaattcgctgttgctgctggtcacagggttc
acgctggtgctaggcacctacgtgctggtgaccttcgacgcgaacgtctcgtga

DBGET integrated database retrieval system