KEGG   Mycobacterium smegmatis JS623: Mycsm_01208Help
Entry
Mycsm_01208       CDS       T02423                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:msa00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221997..1223298
Genome map
AA seq 433 aa AA seqDB search
MTAFAFDAPTVIRTKRDGGVLSDAAIDWVIDGYTHGRVADEQMSALLMAIFLRGMTGAEI
ARWTAAMVDSGERLDFTDLRRDGKPLALVDKHSTGGVGDKITIPLVPVVMACGGAVPQAA
GRGLGHTGGTLDKLESIPGFTAEISKAQIRQQLCDLGAAIFAAGELAPADRKIYALRDVT
ATTESLPLIASSVMSKKIAEGTRALVLDSKVGSGAFLGTEAESRELARTMVELGVAEGLV
TRALLTGMETPLGRTVGNAVEVEESLEVLAGGGPADVVELTLALATEMLDAAGLDAIDPA
QTLKDGSAMDRFRALVAAQGGDLSRPLPIGAYSETISAPRDGTMGLIDAMAVGLTVWRLG
AGRSAPGEQVQCGAGLRIHRRPSEAVAAGEALFTLYTDTPERFEAAMAELDGAWSVGDTA
PAARPLIIDRIVA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgttcgcatttgacgcgccaaccgttattcggaccaaacgcgatggcggcgtc
ttgtccgacgccgcgatcgattgggtgatcgacgggtatacccacggccgcgtcgccgac
gaacagatgtcggcgttgttgatggccatcttcctgcggggaatgaccggtgccgagatt
gcccgctggacggccgcgatggtggattccggtgagcggttggactttacggatctgcgg
cgcgacggcaagccattggcattggtggacaagcactccactggcggcgtcggcgacaag
atcaccattccgcttgttcccgtcgtaatggcatgtgggggagcggtgccacaggccgcg
gggcgcggcctcgggcacaccggcggcaccctcgacaagctggagtccattccgggtttc
accgctgagatatcgaaagcccaaatccgccaacaactttgcgacctcggcgcggcgatt
ttcgccgcgggcgagctggcacccgcggaccggaagatctatgcgctgcgcgatgtcacc
gcgaccaccgagtcgctgccgttgatcgccagctccgtgatgagcaagaagatcgccgag
ggcacccgggccctggtgctcgacagcaaggtcggcagtggggcatttctgggcaccgaa
gcagagtcgcgcgagttggcccgaacgatggtggagctgggcgtcgccgaggggctggtg
acccgcgcactgctgaccggcatggagacgccgttgggccgcaccgtcggcaacgcggtc
gaggtggaggaatcgctggaggtgctcgcggggggaggtccggccgatgtcgtcgagctg
acgctggcactggccaccgagatgctcgacgccgcgggtcttgacgcgatcgatcccgcg
cagaccctgaaggacggctcggcgatggaccggtttcgcgcgcttgtcgccgcgcagggt
ggcgacttgtcccgaccgctgccgatcggtgcgtattccgagaccatctcggcgccgcgc
gatggcacgatgggactcatcgacgcgatggcggtgggactgacggtgtggcggctcggc
gcgggccgctccgccccgggtgagcaggtgcagtgcggcgccgggctgcgcattcatcgc
cgtcccagcgaggccgtcgccgcaggtgaagcgttgttcacgctctacaccgacacccct
gaacggttcgaggccgcgatggccgaactggacggcgcgtggagcgtcggcgatacggcg
cctgccgcccggccgctgatcatcgatcggatcgtggcgtga

DBGET integrated database retrieval system