KEGG   Mycobacterium sp. JS623: Mycsm_01825Help
Entry
Mycsm_01825       CDS       T02423                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00010  Glycolysis / Gluconeogenesis
msa00020  Citrate cycle (TCA cycle)
msa00620  Pyruvate metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01200  Carbon metabolism
Module
msa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycsm_01825
   00020 Citrate cycle (TCA cycle)
    Mycsm_01825
   00620 Pyruvate metabolism
    Mycsm_01825
Enzymes [BR:msa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mycsm_01825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AGB22211
UniProt: L0IW67
Position
1804454..1805770
Genome map
AA seq 438 aa AA seqDB search
MTETHQFTLPDVGEGLTEAEIVKWHVAVGDTVEVNDTLVEVETAKSLVDLPSPYAGVIAK
LHAVEGETVAVGSVIVSFTGAAAASDPAQRDAADSESEPAGEPHQAAAPQPTEQPADERQ
PVLVGYGPSRATVTRRPRKPGYRSPVHPVPVAGAPHRPYATPPVRLRARDLGVDLATVRP
TGAWGQITRTDVDAAQTSAAADEAADPAETRIPVKGVRKATADAMVASAFTAPHVTEWVT
VDVTDSLALLEQLRSDLAFAGVRPTPLVLIVRATLSALRAHPEINAKWDAEAGEIVHYRD
VNLGIAAATPRGLLVPNIKAAQTLSTRELCDRLDELITTARDGKTQPAAMANGTFTITNI
GVFGVDGGTPILNPGEAGILCVGQIARRPWEHQCEITLRSVCTLSLSFDHRLVDGQLGSQ
VLAHVARLLAQPSLALVH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacccaccagttcaccttgcccgacgtcggggaaggactcaccgaagccgag
atcgtcaaatggcatgtcgcagttggcgatacggtcgaggtgaacgacacccttgttgag
gtcgagacagccaaatcgctggtcgatctgccctccccgtacgccggtgtcatcgccaaa
cttcatgcggtcgagggagagacggtcgcggtcggctccgtcatcgtcagcttcaccggc
gcggcggcggccagcgacccggcgcagcgcgacgctgctgattcggaatccgagcccgcg
ggtgaaccgcaccaggcggcagctccgcagccaacggagcaacccgcagacgaacggcag
ccggtgcttgtcggatacgggcccagccgggcgacggtaacgcggcgtccacgtaaaccc
ggatatcgcagcccggtacatccggtaccggtggccggcgcgccccaccggccgtacgcc
acaccgccggtcagactccgggccagagacctcggcgtcgatctggcgacagtgagaccg
acgggtgcgtggggacagatcacccgaaccgacgtcgacgcagcacaaacctcggcggcc
gccgacgaggccgccgatcccgcagagaccaggatcccggtcaaaggcgttcggaaagcg
accgcggacgcgatggtcgcctcggccttcaccgcgccgcacgtcaccgagtgggtcacc
gtcgacgtcacggactccctggcgctgctggaacagctgcgcagcgacctggccttcgcg
ggcgtccggccgaccccgctggtgctcatcgttcgcgcgacgctgtccgcgctgcgcgca
catcccgagatcaacgcgaaatgggacgccgaggcgggcgagatcgtgcactaccgcgac
gtgaatctcggtatcgcggcggccacaccgcgcggtctgctcgtgccgaacatcaaggcg
gcacagacgctttccactcgcgaactctgcgaccggctcgacgaactcattacgacggcc
cgcgacggcaagacccaaccggcggcgatggccaacggcacgttcaccatcaccaacatc
ggtgtcttcggcgtcgacggcggcacgccgatcctcaacccgggtgaggccgggatcctg
tgcgtgggccagattgcccgcaggccttgggaacaccagtgtgagatcacgctacgtagc
gtgtgcaccctgtcgctgtccttcgaccacaggctcgtcgacgggcaactcggcagccag
gtgctcgcccacgtcgcccgactgcttgcccagccgtcacttgccctcgtccactga

DBGET integrated database retrieval system