KEGG   Mycobacterium smegmatis JS623: Mycsm_02204Help
Entry
Mycsm_02204       CDS       T02423                                 

Definition
glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mycsm_02204
Enzymes [BR:msa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Mycsm_02204
Glycosyltransferases [BR:msa01003]
 Polysaccharide
  Storage polysaccharide
   Mycsm_02204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2171961..2173190)
Genome map
AA seq 409 aa AA seqDB search
MVSWEYPPVVVGGLGRHVYNLATALAADGHEIVVLSRRPSGTDPSTHPSTDEIAENVRVI
AAAQDPHEFDFGADMMAWTLAMGHSMVRAGLAINDHRNRQWRPDVVHAHDWLVAHPAIAL
AEYFDVPLVSTIHATEAGRHSGWVAGPISRQVHAVESWLVHESDSLITCSHSMSDEITEL
FGPGLVETRVIRNGIDATLWPFARRQPRTGTAQLMYLGRLEYEKGIHDAIAALPRIRRAH
PGTTLTVAGDGTQLDWLVEQARKYKVLKATTFVGRLDHAELVKLLHSADACVLPSHYEPF
GIVALEAAATGIPLVTSNVGGLGEAVINGQTGMSYAPRDVAGIAAAVCAVLDDPDAAQRM
AVAARERLTSDFDWHTVANETAQVYLVAKRREREPHRRRVIVEHPLPDR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtgggagtacccgccggtggtggtcggcgggctcggcaggcacgtctacaac
ttggcgacggcactcgcggcagacggccacgagatcgtcgtgctgagccgtcggcccagc
ggaaccgacccgagcacacatccgtcgaccgacgaaatcgccgagaacgtacgggttatc
gccgcagcgcaggacccacacgagttcgacttcggcgccgacatgatggcgtggacgctg
gcgatggggcattcgatggtccgcgccggcctcgccatcaacgaccaccgcaaccgacag
tggcgccccgacgtcgtgcacgctcacgactggcttgtcgcacatcccgcgatcgcgctc
gctgaatatttcgacgttccactggtttccacgatccatgccactgaggccggtaggcac
tcgggctgggtggcgggtccgatcagccgccaggtgcacgccgtcgaatcctggcttgtt
cacgaatccgattcgctcatcacatgttcgcactcgatgagcgatgagatcaccgagctc
ttcgggcccggcctcgtcgagacccgcgtcatccgcaacggaatcgatgcgacgctatgg
ccgttcgcgcgacgccagccccgaaccggcacagcgcagctgatgtacctgggccggctc
gagtacgagaagggcattcacgacgcgatcgcggcccttcctcgcatcaggcgtgcacac
cccggcacgaccttgaccgtcgcaggcgacggcacgcagctcgactggctggtcgagcag
gcgcgaaagtacaaggtgctcaaggccacaacgttcgtcggcaggcttgaccacgccgag
ctcgtcaagctgctacacagcgccgacgcatgcgtattgcccagccactatgaaccgttc
ggcatcgtcgcgctcgaagcggcggccactggcatcccgctcgtcacgtccaacgtcggc
ggactcggcgaggcggtgatcaacgggcagaccggaatgtcgtatgccccccgcgatgtc
gcaggcattgctgctgcggtatgcgcagtgctcgacgaccccgacgccgctcagcggatg
gcagtcgctgcccgcgagcgactcacctccgacttcgactggcacaccgtcgccaacgag
accgcgcaggtgtacctggtcgccaagcgccgcgaacgcgaaccgcaccggcgtcgcgtc
atcgtcgagcacccgttgcctgaccgctga

DBGET integrated database retrieval system