KEGG   Mycobacterium smegmatis JS623: Mycsm_02205Help
Entry
Mycsm_02205       CDS       T02423                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2173303..2174880)
Genome map
AA seq 525 aa AA seqDB search
MTSSEPVPHVAGPPAPRSYVAGPPAPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAA
YLPLMRVLRTLADEDRKHVVTLGMTPVVTAQLDDPYCLSGMHHWLANWRLRALEATTLAE
PLRAFGIREQAEAEQALEDFATLWRHGGSPLLRGLIDAGTIELLGGPLSHPFQPLLNPRL
REFALREGLADAGQRFAHTPKGIWAPECAYAPGMEIDYAAAGVGHFMVDGPSLHGDTALG
RPVGSSNVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHVTGLKPARVTGRNVPSDA
KAPYDAERADRAVDVHVEDFVGMVRERLISESERIGRPAHVVAAFDTELFGHWWYEGPVW
LERVLRALPAAGVRVGTLSDAVADGFVGAPVELPPSSWGSGKDWQVWAGEKVADLVQLNT
EVVDTALTTVDKALGETDAPPARNFVADQILRETLLTVSSDWPFMVSKDSAADYARYRAH
LHAHATREIAGALASGRSEHAQRLAEGWNRADGLFGALDARRLPR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagttccgaacccgtaccccatgtcgccggccctccggctccccggtcctatgtc
gccggccctccggctccggggctcttcaccctcgtccttcacacacatctgccgtggcta
gcgcaccacggccgctggcccgtcggcgaggagtggctctaccagtcgtggtcggcggcc
tatctgccgttgatgcgagtgctgcgcacgctcgccgacgaggatcgcaagcatgtcgtg
acgctcggaatgacgccggtggtcacggcgcagctcgacgatccgtactgcctgtccggc
atgcaccactggctggcgaactggcggctgcgggcgctggaggccacgacgcttgcggaa
ccgttgcgcgccttcgggattcgtgaacaagcagaggcagagcaggcactcgaagacttc
gcgacgctgtggcggcacggaggcagtccgttgttgcggggtctgatcgacgcgggcacc
atcgaactgctcgggggcccgctgtcgcatcccttccagccgctgctcaatccgcgactg
cgcgagttcgcattgcgcgagggcctcgcagacgccggccagcggttcgcacacacgccg
aagggcatctgggctccggagtgcgcgtatgcgccgggcatggaaatcgattacgccgca
gcaggtgtcggccacttcatggtggacggcccgtcattgcacggcgacaccgcgctggga
cggccggtcggctcgtcgaacgtcgtggcgttcgggcgcgatctgcaggtcagctaccgg
gtgtggtcgccgaagtcgggctaccccggccatgccgcctatcgcgatttccacacctac
gatcacgtgaccggcctcaaaccggcacgcgtcacgggccgcaacgtgccctcggatgcc
aaggcgccctacgacgctgaacgcgcggaccgggcggtcgacgtgcacgtcgaggacttc
gtcggcatggtgcgcgaacgcctcatcagcgagtccgaacgcatcggcaggcccgcgcat
gtagtggcggcgttcgacaccgaactattcggacactggtggtatgagggcccggtgtgg
ctggagcgggtgctgcgggcactgccagcggccggggttcgggtggggacgctgtcggat
gcggtcgcggacggattcgtcggcgcgccggtcgaattgccgcccagctcttggggttcg
ggcaaggactggcaggtatgggccggcgagaaggtcgccgatctggtgcagctgaacacc
gaggtcgtcgacaccgcgctgactaccgtggacaaggcgctcggcgagaccgacgcaccg
ccggcccgtaacttcgtcgccgaccagatcctgcgcgaaaccctgctcaccgtctccagc
gactggccgttcatggtgagcaaggactccgctgccgactacgcgcgctaccgggcacac
ctccacgcgcatgccactcgcgagattgcaggcgcgctggcgtcgggccgcagcgagcac
gctcaacgcctggccgaaggctggaaccgcgccgacggtttgttcggcgcactcgacgca
aggcgcctcccccgatga

DBGET integrated database retrieval system