KEGG   Mycobacterium smegmatis JS623: Mycsm_02337Help
Entry
Mycsm_02337       CDS       T02423                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycsm_02337
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mycsm_02337
Enzymes [BR:msa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mycsm_02337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2299428..2300348
Genome map
AA seq 306 aa AA seqDB search
MADIELIGVPFDGYGRAGHQARAAAALRDAGLRDAFDHHHVIDDDDLALPDQDPGRGEST
SLINERALLAMTDALNRKVGEVISAGRFPFVYGGDCSTLLGIVTGLRDHVGDVGLVFIDG
HEDTMPLDVSEDGEAANAEIGLLLGLTGRLLTGELGDRLPALRPEQLVILGPRDDDWRRQ
FNVGTLADSRVWLAPLAEVADDPSGAGRRAIERLSGQVDRWWLHIDLDVLDPVDFPAQGL
PDVEDEPGGLTWDQLTDLVSALFTGTASCVGGSIAIYDPDQDPDGAGAAQIVAFIRNVLV
RPTISP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcgaactgatcggggtgccgttcgacggctatgggcgcgccggacatcaa
gcgcgcgccgctgccgcactgcgcgacgccgggcttcgcgacgcgttcgaccatcaccat
gtcatcgatgacgacgacctcgcgttacccgaccaggatccgggccgcggcgagtcgacc
agcctgatcaacgagcgggcactgctggccatgaccgacgcgctcaaccgcaaggtcggg
gaagtgatcagcgcgggccggtttccgttcgtctacggcggtgattgctccacgctgctc
ggcatcgtgaccggactgcgcgatcacgtcggcgacgtcgggctggtgttcatcgacggt
cacgaggacacgatgccgctggacgtgtctgaggatggcgaggctgccaacgccgagatc
gggttgctgctcggtttgacgggtcggctgctgaccggcgagctcggcgatcggctgccc
gcgctgcggcccgagcaattggtgatcctcggtcctcgcgacgacgactggcggcggcag
ttcaacgtaggaacgcttgccgattcacgggtgtggctcgcaccgctggcagaagtcgcc
gacgacccttccggcgcgggacgccgggcgatcgagcggctatcgggtcaggtggaccgg
tggtggttgcacatcgacctcgacgtgctggatcccgtcgattttccggcgcagggcctg
cctgatgtcgaggacgaacccggcggcctgacgtgggatcagctcacagatctcgtctcg
gcgctgttcaccgggacggcgtcgtgtgtcggcggcagcattgcgatttacgatccggat
caggaccccgacggtgccggtgcggcgcagatcgtggcgttcatccgaaacgtgttggta
cgtccgacaatcagtccctag

DBGET integrated database retrieval system