KEGG   Mycobacterium sp. JS623: Mycsm_02423Help
Entry
Mycsm_02423       CDS       T02423                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00900  Terpenoid backbone biosynthesis
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01130  Biosynthesis of antibiotics
Module
msa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mycsm_02423
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mycsm_02423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AGB22760
UniProt: L0IT84
Position
2379527..2380738
Genome map
AA seq 403 aa AA seqDB search
MRDNGSVSTGGQDRSDRGINRVRVLILGSTGSIGTQALDVIAANPDRFEVVGLAAGGGNP
DLLAQQRAETGVTNIAVADDAAAAKVGDVTYAGPDAATQLVENTEADVVLNALVGALGLK
PTLAALGTGARLALANKESLVAGGPLVLKAAKPGQIVPVDSEHSAMAQCLRGGTPDEVAK
IVLTASGGPFRGWPAERLEDVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFG
IPYDRIEVVVHPQSIVHSMVTFTDGSTLAQASPPDMKLPIALALGWPSRVANAALACDFS
TASTWDFEPLDAAVFPAVELAKTAGTKGGCLTAVYNAANEEAAAAFLDGRIRFPAIVRTI
AEVLRAADQWAAQPATVEDVLDAQHWARDRAKGAVSREVVTTK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaatgggtcggtgagtaccggcgggcaggaccgaagcgaccggggaatcaac
cgcgtccgggtgctgatactcggcagcaccggctcgatcggcacccaggcgctggacgtc
atcgccgccaaccccgaccgcttcgaggtcgtcgggctggcggcgggcggcggtaacccg
gacctgctggcccagcagcgcgccgagaccggcgtgacgaacattgccgttgccgatgac
gccgcggccgccaaggtcggcgacgtgacctacgccgggcccgacgccgccacccagctc
gtcgagaacaccgaagccgacgtggtgctcaacgcgctggtcggcgcgctcgggctcaag
ccaaccctggccgcactcggcaccggcgcacggctggcgctggcgaacaaggagtcgctg
gtcgccggcgggccgttggtgctcaaggccgccaagccgggccagatcgtgcccgtcgac
tccgaacattccgcgatggcgcagtgcctacgcggcggtactcccgacgaggtggccaag
atcgtgctgaccgcgtcgggcgggccgttccgcggctggccggccgagcggctcgaggac
gttacccccgagcaggccggcgcgcatcccacctggtcgatgggcccgatgaacacgctg
aattcggcgtcgctggtgaacaagggtctggagctgatcgagacgcacctgctgttcggc
atcccgtatgaccgcatcgaagtcgtggtccacccgcagtcgatcgtgcactccatggtc
accttcaccgacggctcgacgctggcgcaggccagcccgccggatatgaagctgcccatc
gcccttgcccttggctggccgtctcgggtcgccaacgcggccctggcctgtgacttctcc
acagcttcgacctgggatttcgagccgctggatgccgcagtgtttccggccgtggagctg
gcgaaaacggcgggcacgaagggcggctgcctgaccgcggtctacaacgccgccaacgag
gaggccgccgcggcgttcctcgacggccggatccggttccccgcgatcgtgcggacgatt
gccgaggtcctgcgcgctgccgaccagtgggccgcccaacccgctaccgtggaagacgta
cttgatgcgcaacactgggcccgcgaccgggcaaagggcgcagtttcccgggaggtcgtc
accaccaaatga

DBGET integrated database retrieval system