KEGG   Mycobacterium smegmatis JS623: Mycsm_02466Help
Entry
Mycsm_02466       CDS       T02423                                 

Definition
Mg-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mycsm_02466
Enzymes [BR:msa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mycsm_02466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2426359..2428191
Genome map
AA seq 610 aa AA seqDB search
MIPSYPFSAIVGHDRLRLALLLCAVRPEIGGVLIRGEKGTAKSTAVRALAHVLAEVDGAS
LVELPIGATEDRVVGSLDLQKVLRDGEHAFQPGLLARAHRGVLYVDEVNLLHDHLVDVIL
DAAAMGRVHVERDGVSHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVEVRA
DVIRQRMAFEADPAAFAERYASADAELTRRVVAARLRVSSVTLPDNELRRIAALCAAFDV
DGMRADLVVARTAVAHAAWRGADTVAEQDIRVAAELALPHRRRRDPFDDPGLDPDQLDEA
MAQAGESAAEPEPEPEPDPPGGGSDSGQRPENSAPQRNSNSQTRPNAAPSPVFRTRALVV
PGVGEGAPGRRSRARNRTGKTISSTNARDAGHGVHVFGTLLAAAGRQRRPGRPRPEPDDV
RRAIREGREGNLVIFVVDASGSMAARDRMSAVGGATLSLLRDAYQRRDKVAVITFRQTDA
QLLLPPTSSVHIASRRLARFDTGGKTPLAQGLLAARDVVVREKARDRARRSLIVVLTDGR
ATGGPDPLGRARAAASLLVAEGAATVVVDCETSYVRLGLAEQLASQLGAPAVRLAQLRAD
ALTGVVRTAA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgataccgagctatccgttcagcgcgatcgtcggccatgaccggctgcggttggcgctg
ctgttgtgcgcggtgcggcccgagatcgggggtgtgctgatccgcggcgagaagggcacg
gcgaagtcgacggcagtgcgagcgcttgcgcatgtgctggccgaagtcgatggggcgtcg
ttggtcgaattgccgatcggcgccaccgaagatcgtgtggtcggctcgctggacctgcag
aaggtgctgcgcgacggcgagcacgccttccagccgggtctgctcgcccgcgcacaccgg
ggcgtcctctacgtcgacgaggtgaacctgctgcatgaccacttggtcgatgtgatcctt
gacgccgccgcgatgggccgtgtccacgtcgagcgcgacggcgtctcgcacagccacgag
gcccgcttcgtattgatcggaacgatgaatcccgaagagggcgaactgcgtccgcagctg
ctcgatcggttcgggctcacggtcgacgtacacgcgtcacgcgacgtcgaggtacgcgcc
gacgtgatccggcaacggatggcgtttgaggccgatcccgccgcgttcgccgaacgctat
gcttcagcggacgccgagttgacgcggcgtgttgtagctgcccggcttcgggtgagttcg
gttacattgccggacaacgagttacggcgcatcgcggcgctgtgcgcggccttcgacgtc
gacgggatgcgcgccgatctggtggtggcacgcacggctgtcgcgcacgcagcgtggcga
ggcgccgacaccgtggcggagcaagacattcgggtggccgcagaactggcgctgccgcac
cgccgtcgccgcgatccattcgacgatcctggcctcgaccccgaccagctcgacgaggcg
atggcgcaggccggcgagtccgcagccgaaccagagccggaacccgagccggacccgccg
ggtggtggatcggattcgggccagagacccgaaaattcggcgccgcaacgtaattcgaat
tcgcagacccggccgaacgccgcgccgtcgccggtgtttcggactcgggcgctggtagtg
cccggtgtcggcgagggggcacctggccggcgctcgcgggcgcgtaaccgcacgggcaag
acgatctcgtcgaccaacgcgcgggacgcgggtcacggcgtgcatgtgttcggcacactg
ctggccgccgcgggtcgccagcgccgccccggcaggccgcgccccgaaccggatgacgtg
cgtcgggcgatcagggagggccgtgaaggcaacctcgtcatcttcgtcgtcgacgcctcg
ggttcaatggccgcgcgtgaccggatgtctgccgtcggtggcgcgacgttgtcgctgttg
cgcgacgcgtaccagcgccgcgacaaggtggccgtgatcacgttccggcaaaccgacgct
cagttgttgttgccgccgacgtcctcggtgcacatcgcgagccgacggttggcccggttc
gacaccggcgggaaaacgccactggcgcaaggcttactggccgcacgcgacgtggtggtg
cgcgagaaggcgcgtgacagggcacggcgcagcctcatcgtcgtgctcaccgacgggcgc
gctacgggcgggccggatccactgggccgggcccgggcggccgccagcctgcttgtcgcc
gagggtgccgcgaccgtcgtcgtggactgtgaaacctcatacgtgcgtttgggtttagcc
gagcaactcgccagccagctcggtgcgcctgctgtgcgcttagcacaattacgcgccgat
gcgctcaccggcgtcgtgcgcacggccgcataa

DBGET integrated database retrieval system