KEGG   Mycobacterium smegmatis JS623: Mycsm_02511Help
Entry
Mycsm_02511       CDS       T02423                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mycsm_02511
   00670 One carbon pool by folate
    Mycsm_02511
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mycsm_02511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2469952..2470443
Genome map
AA seq 163 aa AA seqDB search
MTTVGLIWAQSTSGVIGRDGGIPWRLPEDQARFKDLTMGHTVVMGRLTWESLPAKVRPLP
GRRNVVVTRQAGYPAEGAQVVPSFDDALTGDDTWVIGGAQIYALALPIATRCEVTEVEID
LRRQDTDAVAPVLDESWLGTSGDWLTSSSGLRYRFDSYLRQRR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgtcggcctgatctgggcccagtccacctctggtgtcatcggccgcgacggc
ggcatcccctggcggctgcccgaggaccaggcgcgcttcaaagacctcaccatgggccac
accgtcgtgatgggcaggctgacgtgggaatcgctgccagccaaggtgcggccactgccg
gggcgccgaaacgtcgtcgtcacgcggcaggccggttacccggccgagggcgctcaggtc
gtcccgtcattcgacgacgcgctcaccggcgacgacacgtgggtgatcggcggcgcgcag
atttacgcgctggcactgccgattgcgacgcggtgtgaagtcaccgaggtcgagatcgac
ttgcggcggcaagacaccgatgcagtcgcgccggtgctcgacgaaagctggctcgggacc
agtggagactggctcaccagcagctccgggttgcgttatcggttcgacagctatttgagg
caacgccggtaa

DBGET integrated database retrieval system