KEGG   Mycobacterium sp. JS623: Mycsm_02599Help
Entry
Mycsm_02599       CDS       T02423                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00010  Glycolysis / Gluconeogenesis
msa00520  Amino sugar and nucleotide sugar metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01200  Carbon metabolism
Module
msa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycsm_02599
   00520 Amino sugar and nucleotide sugar metabolism
    Mycsm_02599
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mycsm_02599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGB22934
UniProt: L0IV86
Position
complement(2548172..2548981)
Genome map
AA seq 269 aa AA seqDB search
MTATDSPAADPATNGGSQRRGFGIDVGGSGVKGGIVDLDTGQLIGERFKLETPQPATPDS
VAQTVAAVVKQFGWTERLGVTYPGVITDGIVRTAANVDKRWLGVNVRETFAKALDGQQVT
VLNDADAAGLAEEKFGAGRDNSGVIVLLTFGTGIGSAVIHNGVLLPNTEFGHLEVGGKEA
EHRAASSIKEKKGWSYERWTKEVTSVLVAIENAIWPDLFIAGGGISRKADKWIPLLKNRT
PVVAAALQNTAGIVGAAMAAEVDVTATGK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgattcacccgccgcggaccccgccaccaacggcggctcgcaacgccgc
ggcttcggtatcgacgtcggcggcagcggcgtcaagggcggcatcgtcgaccttgacacc
gggcagctgatcggcgagcgcttcaagctggagaccccgcaaccggccactccagactcg
gtcgcccagacggtcgccgcggtcgtcaagcagttcggctggacggagcgcctgggcgtc
acctaccccggcgtcatcaccgacggcatcgtccgcaccgcggccaacgtcgacaagcgc
tggctcggcgtcaacgtgcgcgagacgttcgccaaggcgctcgacggccagcaggtgacc
gtgctcaacgacgccgacgcggcgggactggccgaggagaagttcggcgcgggccgggac
aattccggggttatcgtgctgctgacgttcggcaccggcatcggctcggcggtgatccac
aacggggtgttgctgcccaataccgagttcggtcatctcgaggtcggcggtaaagaagcc
gagcaccgcgcggcgtcgtcgatcaaggagaagaagggctggagctacgagcgctggaca
aaagaggtgaccagcgtgctcgttgccatcgaaaacgcaatctggcccgacctgttcatc
gcgggcggcggcatcagtcgcaaggcagacaagtggattccgctgttgaagaaccgcacg
ccggtggtggccgccgcgctgcaaaacacggcaggcatcgtcggcgcggcgatggccgct
gaggtcgacgtcaccgctactgggaagtag

DBGET integrated database retrieval system