KEGG   Mycobacterium sp. JS623: Mycsm_02720Help
Entry
Mycsm_02720       CDS       T02423                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msa  Mycobacterium sp. JS623
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mycsm_02720
Enzymes [BR:msa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mycsm_02720
DNA repair and recombination proteins [BR:msa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mycsm_02720
    RecFOR pathway proteins
     Mycsm_02720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2658103..2658690
Genome map
AA seq 195 aa AA seqDB search
MIASVRGEVLDIALDHVVIEACGVGYKVMATPSTLATLRRGSETRLITAMIVREDSQTLY
GFADADARDLFLTLLGVSGVGPKIALATLAVYDAPSLRQALSDGDVTALTRVPGIGRRGA
ERMVLELRDKIGATHPAGAVALNGHSVRTPVVEALVGLGFALKQAEEATDKVLANEPEAT
TSSALRLALSMLGKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcatccgttcgcggcgaagtcctcgatatcgcactcgaccacgtcgtcatcgaa
gcatgcggcgtcggctacaaggtgatggcaaccccttcgacgctggcgacgctgcgccgc
ggcagcgagacccggctgatcaccgcgatgatcgtgcgcgaggactcgcagacgctgtac
ggcttcgctgacgccgatgcgcgtgatctgttcctgacgctgctcggggtttccggggtg
ggccccaagatcgcgctggccactctcgccgtttatgacgcgccgtcgctgcggcaggcc
ctgtccgacggcgacgtcaccgcgttgacccgggtgcccggtatcggtagacgtggcgcc
gagcgcatggtgctcgagctgcgcgacaagatcggggcaacgcacccggcaggtgcggtg
gcgttgaacggtcactcggtgcgcactccggtcgtggaagcccttgtcggacttggcttt
gcgctcaagcaggccgaagaggccaccgacaaggtgctcgccaacgagccggaggccacc
acgtcaagcgcgctgcggttggcgctgtcgatgctgggtaaaaagtga

DBGET integrated database retrieval system