KEGG   Mycobacterium smegmatis JS623: Mycsm_02816Help
Entry
Mycsm_02816       CDS       T02423                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mycsm_02816
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mycsm_02816
Enzymes [BR:msa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mycsm_02816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2754315..2755262
Genome map
AA seq 315 aa AA seqDB search
MKHLLSAGDLSRDDALAILDDADRFSQSLLGREVKKLPTLRGRTIITMFYENSTRTRVSF
EVAGKWMSADVINVSASGSSVSKGESLRDTALTLRAAGADALIIRHPASGAAQQLAEWTA
TEHGGPVVINAGDGTHEHPTQALLDALTIRQRLGSIDGKRVVIVGDVLHSRVARSNVLLL
ATLGAEVVLVAPPTLLPVGVAEWPVTVSHDLDAELPLADAVLMLRVQAERMNGGFFPSAR
EYSVLYGLSEKRQALLPGNAVVLHPGPMVRGMEIAFSVADSTQSAVLQQVSNGVHVRMAV
LFHLLVGAGQEAISA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctgctctcggccggcgacctgtcccgcgacgacgcgctggccattctcgac
gacgccgaccggttcagccagtcattgctcggccgcgaggtcaagaaattgccgacgctc
cgcggccgcaccatcatcacgatgttctacgagaactccacccgcacccgggtctcgttc
gaggtggcgggcaagtggatgagcgccgacgtcatcaacgtcagcgcttcgggatcgtct
gtctccaaaggagagtcgctgcgcgacaccgcgttgacgctgcgggccgcaggcgctgac
gcgttgatcatccgccatcctgcctccggcgcagcccagcagctcgccgaatggacggcg
accgagcatggcggcccggtggtgatcaacgccggcgacggcacccacgaacatccgacg
caggcgctactcgacgcgctgaccatccggcagcggctgggcagcatcgacggcaagcgg
gtggtgatcgtcggcgacgtcctccacagccgggtcgcgcgctccaatgtgctgctgctc
gccaccctcggcgccgaagtggtgctcgtcgcgccgcccaccttgctgccggtcggcgtc
gccgagtggccggtcaccgtttcacatgacctcgatgccgaactgccgctggccgacgcg
gtgctcatgctgcgcgtccaggcagagcggatgaacggcggcttcttcccgtcggcgcgc
gagtactcggtcctctacggactctccgagaagcgtcaggcgctgctgcccggcaacgcc
gtggtgctgcaccctggcccgatggtgcgcggcatggagattgcgttctcggtcgccgat
tcgacgcaatcggcggtgctgcagcaggtttccaacggtgtgcacgttcgaatggcggtg
ctgttccacttactcgtcggcgccgggcaggaggcgatcagcgcatga

DBGET integrated database retrieval system