KEGG   Mycobacterium smegmatis JS623: Mycsm_02968Help
Entry
Mycsm_02968       CDS       T02423                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycsm_02968
  Amino acid metabolism
   00340 Histidine metabolism
    Mycsm_02968
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mycsm_02968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2908281..2909609
Genome map
AA seq 442 aa AA seqDB search
MASFTMTRIDLRSRSLGAAQLRAALPRGGVDVDAVVPKVRPIVDAVAERGAEAALEYGAS
FDGVRPATVRVPANELDAALAALDADVHAALQVSIDRARAVHSDQRRTDTTTSLAPGATV
TERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQIAGVDSLVIASPPQADFGGLPHPTILA
AAKLLGVDEVWAVGGAQSIALLAHGGTDTDGAELSPVDMITGPGNIYVTAAKRICRSQVG
IDAEAGPTEIAILADHTANPVHVAADLISQAEHDEMAASVLVTDSLTLADATDRELANQL
ETTVHRERVTAALTGKQSAIVLVDDIDAGVRTVNAYAAEHLEIQTVDAREVANRIRSAGA
IFVGAYAPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLKGIHVVDYDEAALKDVSGYV
ITLSQAENLPAHGEAVRRRFET
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttcacgatgacccgcatcgacctgcgcagccgctcgctgggcgcagcacag
cttcgtgccgcgctgccgcgcggtggcgtggacgtggacgcggtggtccccaaggtgcgc
cccatcgtcgatgcggtcgccgagcggggcgccgaggccgccctcgaatacggtgcgtcg
ttcgacggcgtgcggcccgcgaccgtccgggtgccggcgaacgagctggacgcggcgctc
gccgcattggatgccgacgtccacgcggctctgcaagtgtccattgaccgggcccgcgcc
gtgcacagcgaccagcggcgcaccgacaccacaaccagccttgcgcccggcgcgacagtc
accgaacgctgggtgcccgtcgagcgcgtcggcctctacgtgcccggcggcaacgccgtc
tacccgtcgagcgtcgtgatgaacgtggtgcccgcacagatcgccggcgttgactcgctg
gtgatcgcgagcccgccgcaggccgactttggcggcctaccccatccgaccatcctggcc
gccgccaagctgctgggggtcgacgaggtgtgggcggtcggcggtgcgcagtccattgcg
ctgctggcccatggcggcaccgacactgatggtgcagagctgtcgcccgtcgacatgatc
accgggccgggcaacatctacgttactgccgccaagcggatctgccgttcgcaggtcggc
atcgacgcggaggccggaccgacggaaatcgcaatcctcgctgaccacaccgcgaaccca
gtgcatgtcgccgcggatctgatcagccaggccgaacacgatgagatggccgccagtgtg
ctcgtcaccgacagcctgacgctcgccgacgccaccgatcgggagctggccaaccagctg
gagaccaccgtgcaccgcgagcgggtgaccgcggcgctgaccggcaagcagtcggccatc
gtgctggtcgacgacatcgatgccggggtgcgcaccgtcaacgcgtacgccgccgaacac
ctggagatccagaccgtcgacgcgcgcgaggtagccaaccgaatccgttcggcgggagca
attttcgtgggcgcctatgcaccggtcagccttggtgactactgcgccgggtccaaccac
gtgctgccgacagcggggtgtgcacggcactcgagcgggctttcggtgcagacgttcctc
aaaggcatccacgtcgtcgactacgacgaggctgcgctgaaggatgtgtccggctacgtg
atcaccttgtctcaagccgagaacctgcccgcccatggcgaggcggtcaggcggaggttc
gaaacgtga

DBGET integrated database retrieval system