KEGG   Mycobacterium smegmatis JS623: Mycsm_02984Help
Entry
Mycsm_02984       CDS       T02423                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycsm_02984
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mycsm_02984
Enzymes [BR:msa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mycsm_02984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2921313..2922131
Genome map
AA seq 272 aa AA seqDB search
MSSATVLDSIIEGVRADVAAREAVVPLTEIKQMAKDAPPPLDVLAALREPGIGVIAEVKR
ASPSRGELATISDPAKLASAYQDGGARVISVLTEQRRFNGSLDDLDAVRAAVSIPVLRKD
FIVRPYQIHEARAHGADMLLLIVAALEQSVLEPMLDRTESLGMTALVEVHTEEEADRALQ
AGAKVIGVNARDLKTLDVDRDCFARIAPGLPSNVIRIAESGIRGTADLLAYAGAGADAVL
VGEGLVTSGDPRSAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcgactgtgctcgactccatcatcgagggagttcgcgccgacgtagccgcc
cgtgaggctgttgttcccctcaccgagatcaagcagatggccaaggacgcaccgccgccg
ctggatgtgttggccgcgctgcgtgaaccgggcatcggcgtgatcgcggaagtgaagcgg
gccagcccgtcacgcggggaattggcgacgatctccgatcccgccaagctggccagtgcc
taccaggacggaggcgcgcgcgtcatcagtgtgttgaccgaacagcgccggttcaacggc
tcgctcgacgacctcgacgcggtgcgtgcagcggtgtcaatcccggtgttgcgcaaggac
tttatcgtcaggccgtaccagatccacgaagcgcgcgcgcacggtgcggacatgctgctg
ttgatcgtcgcggcgctggagcagtcggtgctcgaacccatgcttgaccgcaccgagtcg
ctcggaatgacggcgctcgtcgaggttcataccgaggaagaggcggatcgcgcgctgcag
gcgggcgcgaaggtgatcggtgtcaacgcccgcgacctcaagacgcttgacgtcgaccgt
gattgcttcgccaggattgcgccggggctgccgagcaacgtcattcggatcgcggagtcc
gggattcgcggcaccgccgatctgctcgcctacgccggagcgggggccgatgcggtgctc
gtcggcgaggggctggtcaccagtggcgatccccgtagcgccgttgccgatttggtcacc
gcaggcacgcatccgtcgtgccccaaacccgcgcgctga

DBGET integrated database retrieval system