KEGG   Mycobacterium sp. JS623: Mycsm_02984Help
Entry
Mycsm_02984       CDS       T02423                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01130  Biosynthesis of antibiotics
msa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mycsm_02984
Enzymes [BR:msa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mycsm_02984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: AGB23307
UniProt: L0IYB8
Position
2921313..2922131
Genome map
AA seq 272 aa AA seqDB search
MSSATVLDSIIEGVRADVAAREAVVPLTEIKQMAKDAPPPLDVLAALREPGIGVIAEVKR
ASPSRGELATISDPAKLASAYQDGGARVISVLTEQRRFNGSLDDLDAVRAAVSIPVLRKD
FIVRPYQIHEARAHGADMLLLIVAALEQSVLEPMLDRTESLGMTALVEVHTEEEADRALQ
AGAKVIGVNARDLKTLDVDRDCFARIAPGLPSNVIRIAESGIRGTADLLAYAGAGADAVL
VGEGLVTSGDPRSAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcgactgtgctcgactccatcatcgagggagttcgcgccgacgtagccgcc
cgtgaggctgttgttcccctcaccgagatcaagcagatggccaaggacgcaccgccgccg
ctggatgtgttggccgcgctgcgtgaaccgggcatcggcgtgatcgcggaagtgaagcgg
gccagcccgtcacgcggggaattggcgacgatctccgatcccgccaagctggccagtgcc
taccaggacggaggcgcgcgcgtcatcagtgtgttgaccgaacagcgccggttcaacggc
tcgctcgacgacctcgacgcggtgcgtgcagcggtgtcaatcccggtgttgcgcaaggac
tttatcgtcaggccgtaccagatccacgaagcgcgcgcgcacggtgcggacatgctgctg
ttgatcgtcgcggcgctggagcagtcggtgctcgaacccatgcttgaccgcaccgagtcg
ctcggaatgacggcgctcgtcgaggttcataccgaggaagaggcggatcgcgcgctgcag
gcgggcgcgaaggtgatcggtgtcaacgcccgcgacctcaagacgcttgacgtcgaccgt
gattgcttcgccaggattgcgccggggctgccgagcaacgtcattcggatcgcggagtcc
gggattcgcggcaccgccgatctgctcgcctacgccggagcgggggccgatgcggtgctc
gtcggcgaggggctggtcaccagtggcgatccccgtagcgccgttgccgatttggtcacc
gcaggcacgcatccgtcgtgccccaaacccgcgcgctga

DBGET integrated database retrieval system