KEGG   Mycobacterium smegmatis JS623: Mycsm_03012Help
Entry
Mycsm_03012       CDS       T02423                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:msa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2955422..2956369
Genome map
AA seq 315 aa AA seqDB search
MTSQPPIGPVDATRVPRYAGPATFARLPRTDQVTHTDVAVVGIPFDSGVSYRPGARFGPA
HIRAASKLLRPYHPRLDVEPFAVHQVADAGDIAVNPFDIAEAITTIERASDELRYGGTKL
ITLGGDHTIALPLLRSLHRDHGPIAVLHFDAHLDTWDTYFGAPFTHGTPFRRASEEGLLD
PEHCLHVGIRGPLYASTDLTDDKVLGFQVIGTDDFQLDGLAAVIERMRARLGDAPVYVSV
DIDVLDPAHAPGTGTPEAGGITSRELLHCLRNLVGVNLVGADIVEVAPAYDHAEITGIAA
AHVAYELLSVLAASK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacagcccccgatcggaccggtagatgccacccgcgtgccgcgctatgccggc
ccggccacattcgcacgcctgccccgcaccgaccaagtcacccacaccgacgtcgccgtc
gtcggcatcccgttcgattcgggtgtctcttatcggccgggcgcgcgcttcgggccggcc
cacattcgcgccgcgtcgaagctgctgcggccatatcacccgcggctggacgttgagccc
ttcgcggttcaccaggtggccgacgcaggcgacatcgccgtcaacccgttcgacatcgcc
gaggcgatcaccacgatcgagcgcgcgtctgacgaattgcgctacggcgggacgaagctg
atcacgctgggcggtgaccacaccatcgcgctgccgctgctgcggtcactgcaccgcgac
cacggcccgatcgcggtactgcacttcgacgctcacctcgacacctgggacacctacttc
ggtgcgccgttcactcacggcacaccgttccgtcgtgccagcgaagaggggttgctggat
cccgagcactgcctgcatgtcggaattcgcgggcctttgtacgcgtccaccgatctgacc
gacgacaaggtgctcggcttccaggtgatcggcacagacgacttccagctcgacggcctc
gccgcggtgatcgaacggatgcgggcgcgcctgggcgacgcaccggtctacgtgtccgtc
gacatcgacgtgctcgacccggcgcacgcaccgggaaccggcacgccggaggcgggcggc
atcacgagccgcgagctgttgcattgcctgcgaaacctggtgggcgtcaaccttgttggc
gccgacatcgtcgaggtcgcgcccgcgtacgaccacgccgagatcaccggcatcgccgcc
gcccatgtcgcgtacgagctgttgtccgtgctggcggcctccaaatga

DBGET integrated database retrieval system