KEGG   Mycobacterium smegmatis JS623: Mycsm_03119Help
Entry
Mycsm_03119       CDS       T02423                                 

Definition
putative O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:msa00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3066481..3067236)
Genome map
AA seq 251 aa AA seqDB search
MSLKQRVPFLRWSFWRLALGARNITKTGQIGDGREAAAADYVVANARKGDIDDVIAKVDQ
FAYEKSFLINVGDEKGELLDAAVRRANPGLVLELGTYCGYGSLRIARAAPSAKVFSVELS
DANAEVARRIWAHAGVDDRVTCVVGTIGDGGFTLDALADQHGFAGGKLDLLFIDHDKAAY
LADLQSIIDRGWLHRGSIVVADNILIPGAPRYREFMKLQQGKLFDSVEHKTHGEYQTLIP
DLVLESEYLAG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaagcagcgcgtaccgttcctgcgctggtcgttttggcggctggcgctcggg
gcccgcaacatcaccaagaccgggcagatcggcgacggacgcgaggctgccgccgccgac
tatgtggtcgccaacgcacgcaagggcgacatcgacgacgtgatcgccaaggtggaccag
ttcgcgtacgagaagtctttcctgatcaatgtcggcgacgagaaaggcgagctgctcgac
gccgccgtccgccgcgccaaccccggcctcgtgctggagctgggcacctactgcggctac
ggctccctgcggatcgcgcgcgctgcgccgtcggcgaaggtgttctccgtcgagctgtcc
gacgccaatgccgaagtggcgcggcgcatttgggcccacgccggcgtcgacgaccgggtc
acgtgtgtggtcggcacgatcggcgacggcggcttcacgctcgacgcgctggccgatcag
cacgggttcgccggcgggaagttggacctgttgttcatcgaccacgacaaggccgcctac
ctggccgacctgcagagcatcatcgaccggggctggctgcaccgcgggtcgatcgtcgtc
gccgacaacatcctgatacccggcgcgccgaggtaccgcgaattcatgaagctgcagcag
ggcaagctgttcgacagcgtcgagcacaagacgcacggcgagtaccagacgctgataccc
gacctcgtgctggagtcggagtacctagccggctag

DBGET integrated database retrieval system