KEGG   Mycobacterium smegmatis JS623: Mycsm_03231Help
Entry
Mycsm_03231       CDS       T02423                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mycsm_03231
Enzymes [BR:msa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mycsm_03231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3170319..3172454)
Genome map
AA seq 711 aa AA seqDB search
MSELPASLVELARRYGVATEYENWTGRQTVVADSTLIAVLDALGVPAATEDERTAALRAH
DRDYWERALPPAIIGRSGVALSFWVHVTHGDSVGLWLRLEDGSVRTGLRQLENNRAPYDL
GDRLVGEATFELPADLPLGYHQLHLQIGGADTSTLVIVSPASLELPARLGPSRAWGLATQ
LYSVRSQRSWGVGDLTDLTDLAVWSASQHGAAFVLVNPLHAAAPTPPMEPSPYLPTSRRF
INPLYLRVEAIDEFAYVRQRGTVRKLRLDVQALAKKAKLIDRDAAWKAKRAALESVYKVE
RSAGRELAYAAYRQREGRSLDDFATWCALAEQYGNDWHQWPEELQHPSSPSVAEFVAKHA
KAVDFHRWLQWELDDQLTAAQATAVQAGMELGIMHDLAVGVDPNGADAWALQDVLALGVT
AGAPPDAFNQLGQDWSQPPWRPDQLVDHAYEPFRALVNAVLRHAGGVRIDHIIGLFRLWW
IPKGAPPTEGTYVRYDHEAMIGVVALEAHRAGAVVVGEDLGTVEPWVRDYLRERGLFGTS
ILWFEADRDGAGGPLAAEKWREYCLSAVTTHDLPPTAGYLAGEHVRLREELGLLTRPAAE
ELAADQAQQGAWLGELRRVGLLGADPSVDEIVLALHRYLGRTPSKLLALSLADAVGDLRT
QNQPGTTDEYPNWRVPLRGPNGRKLQLEDVFTDSRAAELAEAMKQIVHPPV
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagctgcctgcctcgctcgtcgagttggcgcgccgctacggcgtggcaaccgaa
tacgagaactggaccggcaggcaaaccgtcgttgccgactccacgctgatcgcggtgctc
gacgcactcggcgtgcctgccgcgaccgaggacgagcgcaccgctgcgttgcgggcgcac
gaccgcgactactgggaacgcgcgctgccgccggccatcatcggtcgctcgggggtggcg
ttgtcgttctgggtccatgtcacgcacggcgactccgtcggtctgtggctgcgactggaa
gacggcagcgtgcggaccggccttcgacagctcgaaaacaacagggcgccttatgatctc
ggtgatcggctggttggcgaggccaccttcgagctgcctgccgacctgccgctcggctat
caccaactgcatctgcagatcggtggcgccgataccagcacgctggtcatcgtctccccc
gcgtctctcgaactgcctgccaggcttggcccgagccgggcgtggggactggccacgcag
ctgtacagcgtgcgctcgcaaaggtcttggggcgtaggcgatttgaccgatctgaccgac
ctcgcggtgtggtcggcatcgcagcacggcgcggctttcgttctcgtcaacccgctacac
gcggcggctcctaccccgccgatggagccgtcgccctatctgccgacatcgcggcggttc
atcaaccccttgtatctgcgtgtcgaggccatcgacgaattcgcatacgtccgccagcgc
ggcactgtccgcaagttgcgcctcgacgtgcaggcgctcgccaagaaggccaaactgatc
gatcgggacgccgcatggaaagccaaacgcgccgcgctggaaagcgtgtacaaagtcgaa
cgctcggccgggcgcgaactggcctacgccgcctatcgtcagcgcgaaggccgcagcctc
gacgacttcgccacctggtgtgcgctcgccgagcagtacggcaacgactggcaccagtgg
ccggaagaactccagcacccttcgagcccttcggtcgcggagttcgtcgccaaacacgcc
aaggccgtcgacttccatcgctggctgcaatgggagctcgatgaccagctcaccgcagcg
caggccaccgccgtccaggccggaatggaactcggcatcatgcacgacctcgcggtcggc
gtggatcccaacggcgctgacgcatgggcgttgcaggacgtgctggcgctcggcgtcacc
gcaggtgcgccgcccgatgcgttcaaccagctcggtcaggactggtcgcagccgccctgg
cggcccgaccaattggtagaccacgcctacgagccgtttcgagcattggtcaacgccgta
ctgcggcacgcgggtggcgttcggatcgaccacatcatcggcctgttccggctgtggtgg
attcccaagggcgccccgccgaccgagggcacctatgtgcgctacgaccacgaggcgatg
atcggtgtcgtggcgctcgaggcgcaccgggccggcgctgtggtggtcggcgaagatctc
ggcacggtcgagccctgggtgcgcgattacctgcgcgaacgcgggttgttcggcacctcc
attctgtggttcgaggccgaccgcgacggtgcaggcggaccgctggccgccgagaagtgg
cgcgagtactgcctgtcggcggtgacgacgcacgacttgccgccgacggcaggctacctg
gctggcgaacatgtgcggctgcgagaggagctcggcctgttgacccggcctgctgccgag
gaactcgccgccgaccaggcccaacagggagcgtggctgggcgagctgcgccgggtgggc
ctactcggtgcggatccgagcgtcgacgagatcgtcctcgccctacaccgatatctcggg
cgcaccccctccaagttgttggcgttgtcgctcgccgacgcggtcggcgatttgcgcacc
cagaatcaaccgggcaccaccgatgaatatccaaattggcgggtgccgctgcggggcccc
aacgggcgaaaactccagctcgaggacgttttcaccgactctcgggcggcggagctggcc
gaggcgatgaaacagatcgtgcatcccccggtgtaa

DBGET integrated database retrieval system