KEGG   Mycobacterium smegmatis JS623: Mycsm_03268Help
Entry
Mycsm_03268       CDS       T02423                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycsm_03268
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycsm_03268
   00630 Glyoxylate and dicarboxylate metabolism
    Mycsm_03268
Enzymes [BR:msa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mycsm_03268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3210960..3213158)
Genome map
AA seq 732 aa AA seqDB search
MSNRVTVGNLRVDQVLYDFVNNEALPGTDIDPDSFWAGVDKVVTDLSPQNQDLLARRDDL
QAQIDKYHRQHVIEPLDPDGYKQFLTEIGYLQPEPDDFTITTAGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISEEDGAEKGTSYNKVRGDKVIAYARKFLDTAA
PLASGSWSEATGLKIEDGQLVIELGEASTGLATPGQFVGYTGELGSPQWSVLLRNHGLHV
EILIDPDSPVGSTDDAGIKDVVLESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDL
TEEVAKGGKTFTRVLNQDRTYTRPNPGPDGPSELTLPGRSLLFVRNVGHLMTNDAIVDAE
GNEVFEGIQDALFTSLIAIHGLKQGDGNGPLVNSRTGSVYIVKPKMHGPDEVAYTCELFS
RVEDVLGLPQNTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEA
GPMIRKGAMKSTQWIKAYEDQNVDIGLETGFSGKAQIGKGMWAMTDLMADMVEQKIGQPK
AGATTAWVPSPTAATLHAMHYHEVDVYAVHKELEGKRRAGVDELLTVPLAKELAWAPEEI
REEVDNNCQSILGYVVRWIDAGVGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVIT
EEDVKASLRRMAAVVDEQNAKDPEFRPMAPDPEGSIAFQAAQELILSGGAQPNGYTEPIL
HRRRREYKAAAQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgtgtgacggtggggaacctgcgcgtcgaccaggtgctgtacgacttcgtc
aacaacgaggcgcttccgggcaccgacatcgaccccgacagcttctgggcgggcgtcgac
aaggtcgtcaccgacctgtctccccagaatcaggatctgctggctcgccgcgacgacctg
caggcgcagatcgacaagtatcaccgccagcacgtcatcgagccgctcgacccggacggc
tacaagcagttcctcaccgagatcggctacctgcagcccgagcctgacgacttcaccatc
accaccgcaggcgtggatgacgagatcaccacgaccgcgggtccgcagttggtggtgccg
atcctcaacgcccggttcgcactgaacgccgccaacgcgcgctggggttcgctctatgac
gcgctctacggcaccgacgtcatctcggaagaagacggcgccgaaaagggcaccagctac
aacaaggtgcgcggcgacaaggtcatcgcgtacgcgcgcaaattcctcgacaccgcggcg
ccgctggcgtccggctcgtggagtgaggccaccggactcaagatcgaggacggccaactg
gtcatcgaattgggcgaggcctcgacgggccttgcgacgcccgggcagttcgtcggctac
accggcgaactcggttcgccgcagtggtcggtcttactgcgcaaccacggcctgcacgtc
gagatcctgatcgaccccgactcccccgtcggctcgaccgacgacgcgggcatcaaggac
gtggtgctggagtctgcgatcaccacgatcatggacttcgaggattcggtggccgccgtc
gacgccgacgacaaggtgctcgggtatcgcaactggctcggcctgaacaagggcgatctc
accgaagaggtcgccaagggcggcaagaccttcacccgcgtcctcaaccaggaccgcacc
tacactcggccgaatccgggccctgacgggcctagcgagctgacgctgccggggcgcagc
ctgctgttcgtccgcaacgtgggtcacctgatgaccaacgacgcgatcgtcgacgccgag
ggtaacgaggtgttcgagggcattcaggacgccctgttcaccagcctgatcgcgatccac
ggcctcaagcagggcgacggcaacgggccgctggtgaacagccgcaccggttcggtgtac
atcgtgaagcccaagatgcacggacccgacgaggtggcctacacgtgcgagctgttcagc
cgggtcgaggacgtgctcggcctgccgcagaacacgctcaaggtcggcatcatggacgag
gagcggcgcacgacgctcaacctgaaggcctgcatcaaggccgccgccgaccgggtggtg
ttcatcaacaccggattcctggaccgcaccggcgacgagatccacacctcgatggaggca
gggccaatgatccgcaagggtgcgatgaagagcacccagtggatcaaggcgtacgaagac
cagaacgtcgacatcggcttggagaccggcttctccggtaaggcccagatcggcaagggc
atgtgggcgatgaccgacctgatggccgacatggtcgagcagaagatcggtcagcccaag
gccggcgcgaccaccgcgtgggtgccgtcgccgaccgcggccaccctgcacgccatgcac
taccacgaggtcgacgtctacgcggtgcacaaggaactcgagggtaagcggcgcgcagga
gttgatgagctgttgaccgttccactggcaaaggagctggcgtgggcgcctgaggagatc
cgcgaagaggtcgacaacaattgccagtcgatcctcggctacgtggtgcgctggatcgac
gcgggtgtcggctgctcgaaggtgcccgacatccacaacgtggcattgatggaagaccgt
gcgacgctgcggatttcgagccagctgctggcaaactggttgcgccacggcgtgatcacc
gaagaggacgtgaaggccagcctgcgccggatggctgcggtggtcgacgagcagaacgcc
aaggatcccgaattccggccgatggcaccggatcccgagggcagcatcgcgttccaggcc
gcccaggagttgatcctgtccggtggtgcgcagcccaacggctacaccgagccgatcctg
caccgacgtcgacgcgaatacaaggcagctgcgcagtga

DBGET integrated database retrieval system