KEGG   Mycobacterium smegmatis JS623: Mycsm_03268Help
Entry
Mycsm_03268       CDS       T02423                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycsm_03268
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycsm_03268
   00630 Glyoxylate and dicarboxylate metabolism
    Mycsm_03268
Enzymes [BR:msa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mycsm_03268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3210960..3213158)
Genome map
AA seq 732 aa AA seqDB search
MSNRVTVGNLRVDQVLYDFVNNEALPGTDIDPDSFWAGVDKVVTDLSPQNQDLLARRDDL
QAQIDKYHRQHVIEPLDPDGYKQFLTEIGYLQPEPDDFTITTAGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISEEDGAEKGTSYNKVRGDKVIAYARKFLDTAA
PLASGSWSEATGLKIEDGQLVIELGEASTGLATPGQFVGYTGELGSPQWSVLLRNHGLHV
EILIDPDSPVGSTDDAGIKDVVLESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDL
TEEVAKGGKTFTRVLNQDRTYTRPNPGPDGPSELTLPGRSLLFVRNVGHLMTNDAIVDAE
GNEVFEGIQDALFTSLIAIHGLKQGDGNGPLVNSRTGSVYIVKPKMHGPDEVAYTCELFS
RVEDVLGLPQNTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEA
GPMIRKGAMKSTQWIKAYEDQNVDIGLETGFSGKAQIGKGMWAMTDLMADMVEQKIGQPK
AGATTAWVPSPTAATLHAMHYHEVDVYAVHKELEGKRRAGVDELLTVPLAKELAWAPEEI
REEVDNNCQSILGYVVRWIDAGVGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVIT
EEDVKASLRRMAAVVDEQNAKDPEFRPMAPDPEGSIAFQAAQELILSGGAQPNGYTEPIL
HRRRREYKAAAQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgtgtgacggtggggaacctgcgcgtcgaccaggtgctgtacgacttcgtc
aacaacgaggcgcttccgggcaccgacatcgaccccgacagcttctgggcgggcgtcgac
aaggtcgtcaccgacctgtctccccagaatcaggatctgctggctcgccgcgacgacctg
caggcgcagatcgacaagtatcaccgccagcacgtcatcgagccgctcgacccggacggc
tacaagcagttcctcaccgagatcggctacctgcagcccgagcctgacgacttcaccatc
accaccgcaggcgtggatgacgagatcaccacgaccgcgggtccgcagttggtggtgccg
atcctcaacgcccggttcgcactgaacgccgccaacgcgcgctggggttcgctctatgac
gcgctctacggcaccgacgtcatctcggaagaagacggcgccgaaaagggcaccagctac
aacaaggtgcgcggcgacaaggtcatcgcgtacgcgcgcaaattcctcgacaccgcggcg
ccgctggcgtccggctcgtggagtgaggccaccggactcaagatcgaggacggccaactg
gtcatcgaattgggcgaggcctcgacgggccttgcgacgcccgggcagttcgtcggctac
accggcgaactcggttcgccgcagtggtcggtcttactgcgcaaccacggcctgcacgtc
gagatcctgatcgaccccgactcccccgtcggctcgaccgacgacgcgggcatcaaggac
gtggtgctggagtctgcgatcaccacgatcatggacttcgaggattcggtggccgccgtc
gacgccgacgacaaggtgctcgggtatcgcaactggctcggcctgaacaagggcgatctc
accgaagaggtcgccaagggcggcaagaccttcacccgcgtcctcaaccaggaccgcacc
tacactcggccgaatccgggccctgacgggcctagcgagctgacgctgccggggcgcagc
ctgctgttcgtccgcaacgtgggtcacctgatgaccaacgacgcgatcgtcgacgccgag
ggtaacgaggtgttcgagggcattcaggacgccctgttcaccagcctgatcgcgatccac
ggcctcaagcagggcgacggcaacgggccgctggtgaacagccgcaccggttcggtgtac
atcgtgaagcccaagatgcacggacccgacgaggtggcctacacgtgcgagctgttcagc
cgggtcgaggacgtgctcggcctgccgcagaacacgctcaaggtcggcatcatggacgag
gagcggcgcacgacgctcaacctgaaggcctgcatcaaggccgccgccgaccgggtggtg
ttcatcaacaccggattcctggaccgcaccggcgacgagatccacacctcgatggaggca
gggccaatgatccgcaagggtgcgatgaagagcacccagtggatcaaggcgtacgaagac
cagaacgtcgacatcggcttggagaccggcttctccggtaaggcccagatcggcaagggc
atgtgggcgatgaccgacctgatggccgacatggtcgagcagaagatcggtcagcccaag
gccggcgcgaccaccgcgtgggtgccgtcgccgaccgcggccaccctgcacgccatgcac
taccacgaggtcgacgtctacgcggtgcacaaggaactcgagggtaagcggcgcgcagga
gttgatgagctgttgaccgttccactggcaaaggagctggcgtgggcgcctgaggagatc
cgcgaagaggtcgacaacaattgccagtcgatcctcggctacgtggtgcgctggatcgac
gcgggtgtcggctgctcgaaggtgcccgacatccacaacgtggcattgatggaagaccgt
gcgacgctgcggatttcgagccagctgctggcaaactggttgcgccacggcgtgatcacc
gaagaggacgtgaaggccagcctgcgccggatggctgcggtggtcgacgagcagaacgcc
aaggatcccgaattccggccgatggcaccggatcccgagggcagcatcgcgttccaggcc
gcccaggagttgatcctgtccggtggtgcgcagcccaacggctacaccgagccgatcctg
caccgacgtcgacgcgaatacaaggcagctgcgcagtga

DBGET integrated database retrieval system