KEGG   Mycobacterium sp. JS623: Mycsm_03293Help
Entry
Mycsm_03293       CDS       T02423                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00010  Glycolysis / Gluconeogenesis
msa00071  Fatty acid degradation
msa00350  Tyrosine metabolism
msa00625  Chloroalkane and chloroalkene degradation
msa00626  Naphthalene degradation
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycsm_03293
  Lipid metabolism
   00071 Fatty acid degradation
    Mycsm_03293
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mycsm_03293
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_03293
   00626 Naphthalene degradation
    Mycsm_03293
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mycsm_03293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Fer4_19
Motif
Other DBs
NCBI-ProteinID: AGB23599
UniProt: L0IWV3
Position
3234786..3235799
Genome map
AA seq 337 aa AA seqDB search
MTAPTMSAWRVRQPGPMTTRPLDRVTADVPRPGPGELLVAVHACGVCRTDLHVTEGDLPV
HRPGVIPGHEVVGEVAEVGPDTDDFTVGDRVGIAWLRHTCGHCKFCVRGQENLCPESRYT
GWDADGGYAEFATAPAAFAHRLPTGYSDTELAPLLCAGIIGYRSLMRADLPAGGRLGIYG
FGGSAHLTAQVAIAQGAEVHVMTRGEQARELALSLGAASAQGSTDRPPVPLDSAILFAPV
GDLVLPALEALDRGGTLAIAGIYLSDIPALNYERHVFQERQVRSVTSNTRNDAREFLAFA
GQHHIDVTSPEYPLARADVALTDLSEGRIAGAAVLLV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccaaccatgagcgcgtggcgggtccgacaaccgggcccgatgaccactcgt
ccgctggaccgcgtcaccgccgacgtgccgcggcccgggccgggtgaacttctcgtcgcc
gtgcatgcctgcggggtgtgccgtaccgatctgcacgtgaccgagggggacctgccggtg
catcggccgggcgtgatccccggccacgaggtggtcggcgaggtcgccgaagtcggcccc
gatactgacgacttcacagtcggtgaccgcgtcggcatcgcgtggctgcggcacacctgc
gggcactgcaagttctgcgtccgaggccaggagaacctctgccccgaatcccgctacacc
ggctgggacgccgacggcggctacgccgaattcgccactgcccctgcggctttcgcacat
cgtctgcccacaggctattccgacaccgaattggccccgctgctgtgcgcaggcatcatc
ggctaccgctcactgatgcgagccgatctgccagccggcggccggcttggtatctacggt
ttcggcggcagcgcccacctcaccgcccaggtggccatcgcacagggcgctgaggtccat
gtgatgacccgcggcgagcaggcccgcgagttggcgctgtcactgggcgcggcgtccgcg
cagggctccaccgaccggccgccggtgccactggattctgcgatcctgttcgcgcccgtt
ggcgatctcgtgctgcccgcgctcgaggcgctggaccgtggcggcacgctggccatcgcg
ggcatctacctcagcgacatccccgcactgaactacgagcgccacgtattccaggaacgg
caggtgcgatcggtgacctccaacacccgcaacgacgcccgcgagttcctggcgttcgcc
ggccagcaccacatcgacgtgaccagtccggagtatccgctcgcccgcgcggatgtagcg
ttgacggacctgagcgagggccgcatcgccggcgccgcggtgctgttggtctaa

DBGET integrated database retrieval system