KEGG   Mycobacterium sp. JS623: Mycsm_03299Help
Entry
Mycsm_03299       CDS       T02423                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msa  Mycobacterium sp. JS623
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycsm_03299
   00630 Glyoxylate and dicarboxylate metabolism
    Mycsm_03299
   00640 Propanoate metabolism
    Mycsm_03299
   00650 Butanoate metabolism
    Mycsm_03299
  Lipid metabolism
   00071 Fatty acid degradation
    Mycsm_03299
   00072 Synthesis and degradation of ketone bodies
    Mycsm_03299
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycsm_03299
   00310 Lysine degradation
    Mycsm_03299
   00380 Tryptophan metabolism
    Mycsm_03299
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mycsm_03299
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycsm_03299
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mycsm_03299
Enzymes [BR:msa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mycsm_03299
Exosome [BR:msa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mycsm_03299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3243511..3244986
Genome map
AA seq 491 aa AA seqDB search
MPIDPRTPVLIGYGQVNQHDDHPGVEPVDLMAAAARAAADPRVLEAVDSIRVVNVLSWRY
RDPGLLLAQRLRAKDAATRYTGVGGNVPQTLVNQACLDIQAGRTDTVLIAGAETWRTRTR
LRASGAKPDWTSQDESVPMAERLDEDMQMAGPAELRIKLDRPAYVYPMFEQALRMAAGES
ADEHVRRIGELWSQFSGVAAKNPHAWSREPLAPHQIWQPSPRNRMISWPYTKLMNSNNMV
DQGAVLVLTSAEKATYLQIPSERWVFPYAGTDSHDTYAIGERAEFHSSPAIRIAGQRAMQ
LAGVGVDDLDLIDVYSCFPSAVQVAANELGLPLGDPGRPLTVTGGLTFAGGPWNNYVTHS
IATMAERLVANPGQRGLVTANGGYLTKHSFGVYGTEPPSHEFRWEDVQSEVDREPIREAV
VEWSGVGTVEAWTTPFSRTGTAEKAFLAVRTPEDARALAVIPDPAEADATIRDDIAGAKV
QVNADGTASLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgacccgaggacgccggtactcatcggctacggccaggtcaatcagcacgac
gaccacccaggcgtggaacccgtcgacctgatggcggcggccgcgcgggccgctgcggat
ccgcgggtcctcgaggccgtcgactcgatccgcgtcgtcaacgtgctgtcctggcgctac
cgcgaccctggactgctgctggcccagcggctgcgcgccaaggacgctgcaacccggtac
accggggtcggcggcaatgtgccgcagacactggtcaaccaggcctgcctggacattcag
gcgggccgcactgacacggtactgatcgcgggggccgaaacctggcgtacccgaacacga
ctgcgggccagcggcgccaagccggactggaccagccaggacgagtccgttccgatggcc
gagcgtctcgacgaggacatgcagatggccggccccgcggagctccggatcaagctggac
cggcccgcttatgtctatccgatgttcgagcaggcgctgcggatggcggcaggggagtct
gccgatgagcatgtacgtcgcatcggcgagctgtggtcgcagttcagcggggtggccgcg
aagaatccgcacgcctggagccgcgagccactggcgccgcaccagatctggcagcccagc
ccacgcaaccggatgatcagctggccctacaccaagctgatgaactccaacaacatggtc
gaccagggcgcggtgctggtgctcacctcggcggagaaggcgacgtatctgcaaattcct
tctgagcgttgggttttcccgtacgcgggcaccgattcacacgacacctacgccatcggt
gaacgggccgagttccacagctcacccgcgatcaggatcgccgggcagcgggccatgcag
ttggcaggtgtcggggtcgacgacctcgacctgatcgacgtgtactcgtgtttcccgtcg
gcggtccaggtggcggccaacgagctggggctgccgctcggcgacccgggcaggccgttg
acggtcaccggtggtctgacgttcgcaggggggccgtggaacaactacgtcacccattcg
atcgccaccatggccgagcgccttgtcgccaaccccggccagcgcgggctcgtcaccgcc
aacggcggctacctgaccaagcacagcttcggggtatacggcacggagccgccgagtcac
gagttccgttgggaggacgtgcaatccgaggtagaccgcgaaccgatccgggaggcagtc
gtcgaatggtcaggcgtcggcacggtcgaggcgtggaccaccccgttcagccgcaccggc
accgcagagaaggccttcctggccgtccgcacgcccgaggacgcgcgggcgctcgcggta
atccccgatccggcggaggccgacgccaccatccgcgacgacattgcaggtgccaaggtg
caggtcaacgcggacggcaccgcgagcctgctctag

DBGET integrated database retrieval system