KEGG   Mycobacterium smegmatis JS623: Mycsm_03393Help
Entry
Mycsm_03393       CDS       T02423                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mycsm_03393
Enzymes [BR:msa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mycsm_03393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3325756..3326787)
Genome map
AA seq 343 aa AA seqDB search
MGHDHDHQRDLPPGMAEQLDLAYAGMVSFGHRPFLTEVEQLESWQPDAAIVGAPFDISTT
NRPGARFGPRAIRSTAYEPGTYHLDLGLEIFDWLEVVDFGDAYCPHGQTEVSHTNIRERV
HAVASRGIVPVILGGDHSITWPAATAVADVHGYGNVGIVHFDAHADTADEIEGNLASHGT
PMRRLIESGAVPGTHFVQVGLRGYWPPQDTFEWMLEQGMTWHTMQEIWDRGFKDVMRDAV
SEALAKADKLYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEHDVAGVDVVE
VAPAYDHAELTVNAAHRVVFEALAGMAARRRDAAQAKPGPPAR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggccatgaccatgatcatcagcgcgaccttccgcccggcatggccgagcaactcgac
ttggcctacgccggaatggtgtcgttcggccaccggccgtttctgaccgaagtcgaacaa
ctggaatcgtggcaacccgacgcggcgatcgtcggcgcgccgttcgacatttccaccacc
aaccggcccggtgcccggttcggaccgagggcgatccgctcgaccgcctacgaacccggc
acctatcacctggatctcggcctggagatcttcgactggctggaggttgtcgacttcggc
gacgcctactgcccgcatggccagaccgaggtgtcgcacaccaacattcgtgagcgcgtg
cacgcggtggcgtcacgcggcatcgtgcccgtcatcctcggcggtgaccactcgatcacc
tggccggccgcgaccgcggtggccgacgtgcacggctacggcaacgtcggcatcgtgcac
ttcgacgcccacgccgacaccgccgacgagatcgagggcaacctggccagccacggcacc
ccgatgcgcagactcatcgagtccggcgccgtgccgggcacccatttcgttcaggtgggc
ctgcggggctactggccgccgcaggacacgtttgagtggatgctcgaacagggcatgaca
tggcacaccatgcaggagatctgggaccggggattcaaggatgtgatgcgcgatgcggtc
agcgaggcgctggccaaggccgacaagctttacgtctcggtcgacatcgatgtgcttgac
cccgcgcacgcgccaggcaccggcacaccggagcccggcggaatcaccagcgccgacctg
ctacggatggtgcgccagctgtgctacgaacacgatgtcgcaggcgtggacgtggtcgag
gtggcaccggcctacgaccacgccgagctgaccgtcaacgccgcacaccgcgtggtgttc
gaggcacttgccgggatggccgcgcggcgccgcgacgccgcccaggcaaaaccgggcccg
cccgcacgttag

DBGET integrated database retrieval system