KEGG   Mycobacterium smegmatis JS623: Mycsm_03482Help
Entry
Mycsm_03482       CDS       T02423                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycsm_03482
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mycsm_03482
Enzymes [BR:msa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mycsm_03482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3418841..3421141)
Genome map
AA seq 766 aa AA seqDB search
MAIIEADAQPQTPFERDVADTQRYFDSPRFDGIIRLYSARQVVEQRGTIPSDYIVAREAA
EAFYPRLRELFAQKKSITTFGPYSPGQAVAMKRMGIEGIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPEEAAGLVRALLTADRNQQYLRLQMTDEQRATTPATDFRPFIIADADTGHGG
DPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDVMK
VPGIIVARTDAEAANLTDSRADERDQPFLLGVTNLKIPSYKACFLAMVRRFYNQGVTELN
GHLLYALPDGEYATADAWLERHGIAASVDEAASAYQDRADHSIDALFDKVESEFVDAWQV
DAGLMTYGEAVAELLEFRESEGEPLAMSVAEWRKFSQRAPMYTAREKARELGAAVGWDCE
LAKTPEGYYQVRGGIPYAIAKSLAAAPFADILWMETKTADLADAREFAEAIHAVYPDQML
AYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFITYGGHQVDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEEWLALWGEHNQIGEKLRVQLRPTRPGSDVLELGIFGERDGGEDEKLANAIVD
PIKDRHGRSILTVRDQNTFAEKLRKKRLMDVIHLWLIHRFKAEIVYYVTPTEDNIYQTEK
MKSHGIFSDVYQEVGEIIVADVNQPRIEELLAPDRAALGRLIRKED
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccatcatcgaagcggacgcccagccgcagacacctttcgaacgcgacgttgctgac
acccagcgatacttcgacagcccgcgtttcgacggcatcattcgcctctattcggcccgc
caggtcgtcgagcagcggggcacgatcccctccgattacatcgtggcgcgcgaggccgcg
gaggcgttctaccctcgcctgcgcgaactgttcgcccaaaagaagagcatcaccaccttc
gggccctactcgccaggccaggccgtggcgatgaagcgaatgggtatcgagggcatttac
ctcggcggttgggccacttctgccaagggatcgacgaccgaggaccccgggccagatctg
gccagttatccattgagccaggtgccggaggaagccgcgggcttggtgcgtgcattgctg
accgccgaccgcaatcagcagtacctgcgtttgcagatgaccgacgagcaacgcgccacc
acacccgcgaccgacttccggccgttcatcatcgccgacgcggacaccggccacggcgga
gatcctcacgtgcgcaacctgattcgtcgcttcgtggaggcaggcgtgccgggttaccac
atcgaggatcagcggccaggcaccaagaagtgcggccaccagggcggcaaggttctggtg
ccgtcggatgaacagatcaagcggctgaacaccgctcggttccagctcgacgtgatgaag
gtgcccgggatcatcgtcgcgcgcaccgacgccgaggcggccaacctgaccgacagccgt
gccgatgagcgcgaccagccgttcctgctgggcgtcaccaacttgaagattccgtcgtat
aaggcgtgcttcctggcgatggtgcgacggttctacaaccagggcgtcacggagctcaac
ggtcatctgctctacgcgctgcccgacggcgaatacgccacagccgacgcgtggttggag
cgccacggcatcgcggcctcggttgacgaagccgcgtcggcgtatcaggaccgcgccgat
cattcgatcgatgcgctcttcgacaaggtcgagtcggagttcgtcgatgcctggcaggtg
gatgccgggctgatgacctacggcgaggcggtggccgagctactcgagttccgcgagagc
gaaggcgaaccgctcgcgatgagcgtcgccgagtggcgcaaattctctcagcgcgcaccg
atgtacaccgcccgcgaaaaagcgagggaactcggagccgcggtcggctgggactgcgag
ctcgcgaagacgcctgagggctattaccaggtgcgcggcggcatcccctatgccatcgcg
aaatcgttggcggccgcgccgttcgccgacatcctgtggatggaaacgaagacggccgac
cttgcggatgcccgcgagttcgccgaggcgatccacgccgtgtaccccgaccagatgctg
gcctacaacctgtccccgtcgttcaactgggacaccaccggcatgaccgacgacgaaatg
cgcgcctttcctgaagaactcggcaagatgggcttcgtcttcaacttcatcacctacggc
ggccatcaggtcgacggcgtcgcctccgaggagttcgccaccgcgctgcggcaggacggc
atgctcgcgctggctcggctacagcgcaagatgcggttggtcgaatcgccttatcggaca
ccgcagacccttgtcggcggaccgcgcagcgatgctgcgctcgcggcgtcgtcgggacgc
acggcgaccaccaaggcgatgggcaagggctctacccagcaccagcatctggttcagacc
gaggtgccgaagaagctgctcgaggagtggctggcgctgtggggcgaacacaaccaaatc
ggcgagaagctgcgggtgcaactgcggccaacgcggcccggctcggatgtcctcgaactc
gggatcttcggagaacgtgacggcggcgaggacgagaagctcgccaacgcgatcgtcgac
ccgatcaaggaccggcacggccgcagcattttgactgtgcgcgaccagaacaccttcgcc
gagaagctgcgcaagaagcgtctgatggacgtcatccacctgtggctgatccatcgcttc
aaggccgagatcgtctactacgtcacgccgaccgaggacaacatctaccaaaccgagaag
atgaagtcgcacggcatcttcagcgacgtgtaccaggaggttggcgagatcatcgtcgcc
gacgtgaaccagccacgcatcgaggagctgctcgcgcccgaccgcgcggcgctcggccgg
ttgatccgcaaagaggactag

DBGET integrated database retrieval system