KEGG   Mycobacterium sp. JS623: Mycsm_03808Help
Entry
Mycsm_03808       CDS       T02423                                 

Definition
(GenBank) arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00220  Arginine biosynthesis
msa00330  Arginine and proline metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01130  Biosynthesis of antibiotics
msa01230  Biosynthesis of amino acids
Module
msa_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Mycsm_03808
   00330 Arginine and proline metabolism
    Mycsm_03808
Enzymes [BR:msa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mycsm_03808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGB24079
UniProt: L0IYA0
Position
complement(3730256..3731065)
Genome map
AA seq 269 aa AA seqDB search
MMLALTVFQGRAGDHNDRGFGGAAAVGAEWQHRLGLSATTVGTPEPPLSTDWRTELTAAA
PTLEAMSQRYEDIYTAGQTPVTALTRCAVALATLPVMARFHQDALVVWFDAHGDINTPES
SSTAFLGGLALSGPMGLWDSGLGSGIALANVVLGGARDLDPFERHLIDEGVVRHVPVGPG
LLDDLDAAVGDRPVYFHLDCDVLEPGLVPTDYRVPNGLSLGELRGVASRLAENAVVGVEV
AEFEGTWAKSGDPGDAGPLLDALAPLVEG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcgcactcaccgtatttcagggtcgcgccggcgaccacaacgatcgcggattc
ggcggtgccgcggcagtgggcgcggaatggcaacaccggcttggcctgtccgccacgacc
gtcggcacgccggagcccccgctcagcacggactggcgaaccgaactcacagcggccgca
ccgactctcgaggcgatgtcgcagcgatacgaggacatctacaccgcgggccagacaccg
gtcaccgcattgacgcgctgcgccgtggcattggccacgctgccggtgatggcgcgtttc
caccaggatgcgctcgtggtgtggttcgacgcgcatggcgacatcaacacgcccgagtcg
agcagcacggcgtttctcggcggactggcgctgtcaggtccgatgggtttgtgggactcg
gggctggggtcgggcatcgcactcgccaacgtggtgttgggcggggcgcgcgacctcgac
ccgtttgagcgccacctgatcgacgagggcgtcgtgcgacatgttccggtcggccctggc
ttattggacgacctcgacgcggcggtgggggatcgcccggtgtacttccacctcgactgc
gatgtgctcgagccgggtctggtgccaacggactaccgcgtcccgaacgggctgagcctt
ggtgaattacgcggtgtagcaagccgtttggcggaaaacgccgtcgtcggcgtcgaggtc
gccgagttcgagggaacttgggccaagagtggagatccgggtgacgcggggccacttctt
gatgcccttgcgccgctagttgaaggctga

DBGET integrated database retrieval system