KEGG   Mycobacterium smegmatis JS623: Mycsm_03866Help
Entry
Mycsm_03866       CDS       T02423                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mycsm_03866
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mycsm_03866
Enzymes [BR:msa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mycsm_03866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3785670..3787190)
Genome map
AA seq 506 aa AA seqDB search
MNPRPNHPVGQVLGRLAEQVLAVPAGGVAVPDVRVTGVTLRGQNAQLGDLFAALPGASSH
GGRYAADAVARGAVAVLTDPAGVEAMGDIAVPVLVHPHPRSVLGDLAATVYGHPSERLRV
IGVTGTSGKTTTTYLAEAGLRSAERVAGLIGTVGVRIDGRDQPSVLTTPEAPDLQALLAV
MVEQGVDTVVMEVSSHALTLGRVDGVQFAVGGFTNLSRDHLDFHPTMQDYFAAKARLFDP
ESRSHASLSVICVDDDAGREMARIAHHPVSVSATGRDADWRVENIESVELGAQEFLAVDP
AGVHHGLRIGLPGHYNVANCLLAVALLDAVGVSPEQAAPGLRSATVPGRLEPIDRGQDFL
ALVDYAHKPGALRAVLETLRAQSGGRLAVVFGAGGNRDPGKREPMGRVAAELADLVVITD
DNPRDEEPAAIRAAIMAGARGGQAQVVEIGDRREAIDYAVVWAKSGDVVLIAGKGHEAGQ
TSHGQTRPFDDREELARSLEAHGRCT
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcgtcccaaccatcccgtcggccaagtgctgggacggctggctgagcaggta
ctggccgtacctgccggcggggtcgcggtgccagacgtgcgggtcaccggtgtcacactg
agaggccagaatgcgcagctcggcgacctgttcgcggccctgcccggggcgtcctcgcac
ggtgggcgctatgccgccgacgcggtggctcggggcgctgtcgcggtgctcacggacccg
gcgggcgtcgaagcgatgggcgatatcgcggtgcccgtgctggttcatccccacccgcga
tcggtgttgggcgacctcgcggcgacggtgtacgggcatccgtcggaacggctgcgcgtc
atcggcgtcactgggacgtcaggcaagaccacgacgacgtatctggccgaggccgggctg
cggtcagccgagcgggtggcggggctgatcggcaccgtcggtgtccgcatcgacggacgc
gaccagcccagcgtgctgaccacgccggaggcgccggatctgcaggcgctgctggcggtg
atggtcgagcagggcgtcgacaccgtggtgatggaggtgtccagccacgcgctgacgctt
ggccgcgtggacggtgtgcagttcgcggtcggtggattcaccaacctgtcgcgggaccac
ctggatttccacccaacgatgcaggactacttcgccgccaaagcccgcctgttcgacccc
gaatcacgttcgcacgcaagtctttccgtgatctgcgtggacgatgacgcgggacgggag
atggcgcgtatcgcccatcatccagtctcggtcagcgcaaccggacgcgacgccgactgg
cgagtggagaacatcgagtccgtcgagctcggcgcccaggagtttctggcggtcgacccg
gcgggcgtgcatcacgggctgcggatcgggctgcccggtcactacaacgtcgccaactgc
ctgctggcggtcgcgttgctggatgctgtcggggtatcaccggaacaagcggcgccgggg
ctgcgcagcgctacggtgcccggccggctcgagccgatcgaccgcggccaggactttctc
gcgttggtcgactatgcgcacaagcccggggcgctgcgtgcggtgctcgagacgctgcgc
gcccagagtggcggcaggctcgcggtggtgttcggcgcgggcggcaaccgggatccaggg
aaacgggagccgatgggccgcgtcgccgccgaattggccgacctggtggtcatcaccgac
gacaacccccgcgacgaggaacccgccgccatcagggccgcgatcatggccggcgcacgg
ggtggacaggcgcaggtcgtcgagatcggtgaccgccgcgaggccatcgactacgccgtg
gtgtgggcaaaatcgggtgacgtggtgctgatcgcgggcaagggtcacgaggcgggccag
accagccatggccagacccggcccttcgacgaccgcgaagagcttgctcggtctcttgaa
gcgcacgggcgctgcacgtga

DBGET integrated database retrieval system