KEGG   Mycobacterium smegmatis JS623: Mycsm_03919Help
Entry
Mycsm_03919       CDS       T02423                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycsm_03919
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycsm_03919
  Amino acid metabolism
   00310 Lysine degradation
    Mycsm_03919
Enzymes [BR:msa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mycsm_03919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3840467..3842245
Genome map
AA seq 592 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEVGGELAVIGDASESDGEAKAPAAEEEKPAEEPAAQPEPAAEEQEEPAAEEEP
EPEPAKPAAASSGGGEATSVKMPELGESVTEGTVTRWLKKVGDSVEVDEPLVEVSTDKVD
TEIPSPVAGTLLSITAEEDDTVSVGGELAKIGDASAAAAEAPEPKPEPKPEPKPEPKPEP
KPEPAAEAKPEPKPEPKPEPKPEPKAAPAAEAPSVDGGPYVTPLVRKLAAENNIDLASVK
GTGVGGRIRKQDVLAAAEATKAPAAPAPEAAPAAAPAKPAAAAATPAPALAHLRGTTQKA
NRIRQITAKKTRESLQTTAQLTQTHEVDMTKIVALRAKAKNAFAEREGVKLTYLPFIARA
VIDALKIHPNVNASYNEESKEITYYDAEHLGFAVDTEQGLLSPVIHNAGDLSLGGLARAI
ADIAERARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIS
DAYGNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKRRLEEGAFEADLGL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgttcagatgcccgcgctcggtgagagcgtgaccgagggcactgtcacc
cgctggctcaagcaagagggcgacacggtcgaacaggatgagccgttactcgaggtgtcc
accgacaaggtcgacacggagatcccgtcaccggccgccggtgtgctgacgaagatcgtc
gctcaggaagacgacaccgtggaggtcggcggtgagctcgcggtgatcggcgatgcaagt
gaatccgacggcgaagccaaggccccggccgccgaagaggagaagcctgcggaggagcct
gcggcgcagcccgaaccggcggccgaggagcaggaggagcctgcagccgaggaagagccg
gagcccgaaccggccaaacccgcggcggcctcgtccggcggcggtgaggccacgtcggtg
aagatgcccgaacttggcgagtctgtcacagagggcacggtgacgcgctggctgaagaag
gtcggcgactccgtcgaggtcgacgagccgctggtcgaggtgtccaccgacaaggtcgac
accgagatcccgtcaccggtggcgggcacgctgctgtcgatcaccgccgaagaggacgac
acggtctcggtcggcggcgagttggccaagatcggcgacgccagcgccgcggcggccgag
gcccccgagccgaaaccggaacccaaacccgaaccaaagcccgaaccgaagcccgagccc
aagccggagccggccgccgaagccaagccggaacccaaacccgagcccaagcccgaaccc
aaacccgagcccaaggccgcacccgcggcggaggcgccgtcggtcgacggcggcccgtac
gtcaccccgctggtgcgaaagctggctgccgagaacaacattgacctggcgtcggtcaag
ggcaccggcgtcggcggacggatccgcaagcaggacgtgctcgccgcggccgaagccacg
aaggctcctgccgccccggcacccgaagccgcccctgctgcggcccctgccaaaccggcc
gccgccgcagcgacgccggcacctgcgctggcccacctgcgcggaaccacgcagaaggcc
aaccggattcgtcagatcaccgcgaagaagacccgcgaatccctgcagaccacagcgcaa
ttgacgcagacccacgaggtcgacatgaccaagatcgtggcgctgcgagccaaggcgaag
aatgccttcgccgaacgcgaaggcgtcaaactgacgtatctgccgttcatcgcccgcgcg
gtgatcgacgcgctcaagatccacccgaacgtcaacgccagctacaacgaggaatccaag
gagatcacctactacgacgccgagcatctcggcttcgcggtcgacaccgagcaaggcctg
ctgtctccggtgatccacaacgccggcgatctctcactgggcggcctggcacgggcgatc
gccgacatcgccgagcgtgcgcggtcgggaaacctcaagcccgatgagctgtccggcggg
acgttcacgatcaccaacatcggcagccagggcgcgctgttcgacaccccgatcctggtc
ccgccgcaggcggcgatgctgggcaccggcgcgatcgtcaagcggccgcgggtgatctcc
gacgcgtacggcaacgagtcgatcggcgtgcggtcggtgtgctacctgccgctgacctac
gaccaccggctgatcgacggcgccgatgccggacgcttcctgacgaccatcaagcgccgc
ctcgaagagggtgccttcgaggccgatctcgggctatag

DBGET integrated database retrieval system