KEGG   Mycobacterium smegmatis JS623: Mycsm_04196Help
Entry
Mycsm_04196       CDS       T02423                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mycsm_04196
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mycsm_04196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4114281..4115162
Genome map
AA seq 293 aa AA seqDB search
MVARVCVVGSVNADLTFTVDSLPRPGQTVLASSLSSAPGGKGGNQAVAAARAGAAVQLVA
ALGSDAAADQLRAHLRDNEVGLDGVVSLPGPSGSAVIVVDAAAENTIVVAPGANAHLTVT
SADVRAVIADSDVVLLQLEIPIATAIAAAGVARAADAVVMLNASPAGAAPHQLLALSELA
DVVVVNEAEAREWHWPVPHLVITRGARGASYLGEDERFDVRAPAVEAVDTTGAGDVFAGV
LAADWLDGHEAALRRACAAGALSTLVPGAGDCAPYAEAIDDAVTNRKAEERQI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgcgggtctgcgtagtgggcagtgtcaacgccgacctcactttcaccgtcgat
tcgctgccgcggcccggccagaccgttctcgcgtcctcgctgtcgtcggcgcctggcggc
aaaggcggcaatcaggcggtggccgcggcccgcgcgggcgcggcggtgcaactggtcgcg
gcgctcggcagcgacgccgcggcagatcagttacgcgctcaccttcgcgacaacgaggtc
gggctggacggcgtcgtcagcctgcccggacccagcggctcggcggtgatcgtcgtcgac
gccgcggcggagaacacgattgtcgtggcgcccggcgcgaacgcccacttgaccgtgacg
tccgccgacgtccgcgcggtgatcgccgacagcgacgtcgtgctgctgcaactggagatc
ccgatcgcgacagccattgcagccgcgggagtcgcccgggccgccgacgcggtggtgatg
ctcaacgcctcaccggccggcgctgcgccgcaccagctgcttgccctttccgagctggcc
gatgtcgtcgtcgtgaacgaagccgaagcacgcgaatggcattggcccgtgccgcatctg
gttatcacccgcggcgcgcgcggcgcgagctatctcggcgaggacgaacgattcgacgta
cgcgcccccgccgtcgaggccgtcgacaccaccggcgctggcgatgtttttgccggggtg
ctggccgctgactggctggacggccacgaggccgcgctgcggcgcgcgtgtgcggcaggc
gctttgtcgacgctcgtccctggagccggcgactgcgccccatacgccgaggcgatcgat
gacgcggtgaccaaccgaaaggccgaggaaaggcagatatga

DBGET integrated database retrieval system