KEGG   Mycobacterium smegmatis JS623: Mycsm_04629Help
Entry
Mycsm_04629       CDS       T02423                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4567047..4569254
Genome map
AA seq 735 aa AA seqDB search
MTQTNQLTSPHLRPHTADLTRLLAGEHHDPHSVLGAHEYGDHTVIRAYRPHAVEVAALIG
GERYVFQHIEAGIFAVAVPFTDLVDYRLEVAYDTGGESPHLHTVADAYRFLPTLGEIDLH
LFAEGRHERLWEILGAHPRRFTTPDGVVDGVSFAVWAPNAKGVSLIGEFNHWDGNEAQLR
VLGSTGVWELFWPGFEIGGLYKFRVHGADGAVTERADPMAFATEVPPQTASKVTKSDYTW
DDAHWMTKRATQNPVFEPMSTYEVHLMSWRPGLSYRQLADELTEYVVGQGFTHVELMPVA
EHPFGGSWGYQVTSYYAPTSRLGTPDDFRYLVDKLHQAGIGVIMDWVPAHFPKDAWALGR
FDGTALYEHSDPRRGEQLDWGTYVFDFGRAEVRNFLVANALYWLQEFHIDGLRVDAVASM
LYLDYSRPEGGWTPNIYGGRENLEAVQFLQEMNATVHKLAPGIVTVAEESTSWPGVTRAT
NLGGLGFSMKWNMGWMNDTLEFIKRDPIHRSYHHHEITFSMLYAYSENFVLPISHDEVVH
GKGTLWGRMPGNDHVKAAGMRGLLAYQWAHPGKQLLFMGQEFGQRAEWSEERGVDWYQLD
ESSFSNGIQRMMQDMNGIYRSRRALWSQDTRPEGYSWIDANDSANNVLSFMRFGDDGSML
ACVFNFSGSEHARYRLGLPHAGTWREVLNTDADIYNGTGIGNYGAVEATDEPWHGRPASA
VMVLPPLAALWFEPA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaccaaccaactcacgagcccgcatttgcggccgcacacggcagacctgaca
cggctgcttgccggcgagcaccacgacccgcattcggttctgggtgcccacgaatacggc
gatcacaccgtaattcgcgcctaccggccgcatgccgtcgaggtggcggcgctcatcggc
ggtgagcgctacgtgttccagcacatcgaggccgggatcttcgcggtcgcagtgccgttc
accgatctggtggattaccggctcgaggtcgcctacgacacgggcggcgaatccccgcat
ctgcacactgtggccgacgcctaccgcttcctgccgaccctcggcgagatcgatctgcac
ctcttcgccgagggccgacacgagcggctgtgggagatcctgggcgcgcacccgcggcgg
ttcaccacccccgatggcgtcgtcgatggtgtgtcgttcgcggtgtgggcgccgaatgcc
aagggcgtcagcctgatcggtgagttcaaccactgggatggcaacgaggcacagctgcgg
gtgcttggctcgaccggcgtctgggagttgttctggcctggcttcgagatcggcggactg
tacaagttccgcgtgcacggggcagacggcgcggtgaccgagcgagccgacccgatggcg
ttcgcaacggaggtgccgccgcagacggcgtcgaaggtgaccaagagcgactacacctgg
gatgacgcacactggatgacaaagcgggcgacgcagaacccggtgttcgagccgatgagc
acctatgaagtccatctgatgtcatggcggccaggactgagctatcggcagctggccgat
gagttgacggaatacgttgtcggtcagggcttcacacacgttgagctgatgccggtggcc
gagcatccgttcggcgggtcatggggctaccaggtcacctcttactacgcaccgacgtcg
cggctcggcacccccgacgatttccggtacctcgtcgacaagctgcatcaggccggcatc
ggcgtgatcatggactgggtgcccgcgcacttcccgaaggacgcgtgggcgctcggccgc
ttcgacggcaccgctctgtacgagcactccgatccgcgccgcggtgagcaattggattgg
ggtacttatgtgttcgacttcggcagggccgaggtgcgcaacttccttgtcgccaatgcg
ttgtactggctgcaggagttccacatcgacgggctgcgggtcgacgccgtcgcatcaatg
ctctatctcgactactcgcgaccggaaggcggctggacgccgaatatctacggtggccgg
gagaacctcgaggccgtgcagttcctgcaggagatgaacgccacggtgcacaagttggcg
cccggcatcgtcaccgtggccgaggagtcgacgtcgtggcccggcgttacgcgggcgacc
aaccttggcggccttggcttttcgatgaagtggaacatgggttggatgaacgacacgcta
gagttcatcaagcgcgacccgattcaccgcagttaccaccaccacgagatcacgttctcg
atgctgtacgcgtacagcgagaacttcgtgttgccgatcagccacgacgaagtggtgcac
ggcaagggcacgctgtggggccggatgcctggtaatgaccacgtaaaggccgcgggcatg
cgcggattgctggcttaccagtgggcacacccgggcaagcaactgctgttcatgggtcag
gagttcggccagcgcgcggagtggtcggaggaacggggcgtcgactggtatcagctcgat
gagagcagcttctccaacgggattcagcggatgatgcaggacatgaacggcatctaccgc
agccgtcgcgcgctgtggtcacaggacacccggccggagggctattcgtggatcgacgcc
aacgactcggccaacaatgtgttgagcttcatgcgtttcggtgacgacgggtcgatgttg
gcgtgcgtgttcaacttctccggttccgagcacgcccgctaccggctgggtctgccccac
gctggcacgtggcgtgaagtgctgaacaccgatgccgacatctacaacggcacaggcatc
ggtaactacggcgccgtggaggccaccgacgagccgtggcatggccgtcccgcctcagcg
gtcatggtgctgccgccgctggccgcgctgtggttcgagccggcctaa

DBGET integrated database retrieval system