KEGG   Mycobacterium sp. JS623: Mycsm_04728Help
Entry
Mycsm_04728       CDS       T02423                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00260  Glycine, serine and threonine metabolism
msa00750  Vitamin B6 metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01230  Biosynthesis of amino acids
Module
msa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycsm_04728
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mycsm_04728
Enzymes [BR:msa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mycsm_04728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AGB24954
UniProt: L0J0X0
Position
complement(4669123..4670205)
Genome map
AA seq 360 aa AA seqDB search
MTAPRTAVHQPWPGLIAAYRDRLPVEDSWTAITLLEGGTPLVSAPRLSEYTGCTVHLKVE
GLNPTGSFKDRGMTMAVTEAVARGQKAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQVDGNFDDCLELARKLTADYPTVSLVNSVNPYRIEGQKTAAFEI
VDALGTAPDVHSLPVGNAGNITAYWKGYTEYHRDGVSDRLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWATAVEAQQQSNGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSIEDGWVTKGSTVVCTVTGNGLKDPDTALKGMPSVTPVPVDPTAVVEKLGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccaggaccgcggtgcaccagccctggccgggtctgatcgccgcctaccgc
gaccggctgcccgtcgaggacagctggaccgcgatcacgcttctcgagggcggcaccccg
ttggtgtccgcgccgcggctatccgaatataccggctgcacagtgcatctcaaggtggag
gggctcaacccgaccggctcgttcaaggaccgcggcatgaccatggccgtcaccgaggcc
gtggcccgtgggcagaaggccgtgctgtgcgcgtcgacgggcaacacgtcggcctcggcg
gccgcctacgccgcacgggctggcatcacgtgtgcggtgctgattccgcagggcaagatc
gcgatgggcaagctcgcgcaggcggtcatgcacggcgcgaagatcattcaggtcgacggc
aacttcgacgactgcctcgagctggcccgcaagctcaccgccgactatccgacggtctcg
ctggtcaactccgtcaacccgtaccgcatcgagggacagaagaccgctgcgttcgagatc
gtcgacgcgcttggcaccgcgcctgatgtgcactcactgcccgtcggcaacgcgggcaac
atcaccgcgtattggaagggctacacggaataccaccgcgacggggtgtccgaccggctg
ccccgcatgctgggcacgcaggcagcgggagcggcgccgctggtgctgggggagccggtg
agccaccccgagaccatcgccaccgcgatccggatcggctcgcccgcgtcgtgggccacc
gcggtcgaggcgcagcagcagtccaacggccgattcctggccgccaccgacgaggagatc
ctcgccgcgtatcacctggtggcgcgcaccgaaggcgtgttcgtcgagccggcatcggcg
gccagcatcgcgggcctgctcaagtcgatcgaggacggctgggtgacgaaggggtcgacc
gtggtgtgcacggtgaccggcaacgggctcaaggatcccgacaccgcgctcaagggcatg
ccgtccgtcacgccggtgccggtcgatcccacggctgtcgtcgagaaactgggtttggtc
taa

DBGET integrated database retrieval system