KEGG   Mycobacterium smegmatis JS623: Mycsm_04728Help
Entry
Mycsm_04728       CDS       T02423                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycsm_04728
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycsm_04728
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mycsm_04728
Enzymes [BR:msa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mycsm_04728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4669123..4670205)
Genome map
AA seq 360 aa AA seqDB search
MTAPRTAVHQPWPGLIAAYRDRLPVEDSWTAITLLEGGTPLVSAPRLSEYTGCTVHLKVE
GLNPTGSFKDRGMTMAVTEAVARGQKAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQVDGNFDDCLELARKLTADYPTVSLVNSVNPYRIEGQKTAAFEI
VDALGTAPDVHSLPVGNAGNITAYWKGYTEYHRDGVSDRLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWATAVEAQQQSNGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSIEDGWVTKGSTVVCTVTGNGLKDPDTALKGMPSVTPVPVDPTAVVEKLGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccaggaccgcggtgcaccagccctggccgggtctgatcgccgcctaccgc
gaccggctgcccgtcgaggacagctggaccgcgatcacgcttctcgagggcggcaccccg
ttggtgtccgcgccgcggctatccgaatataccggctgcacagtgcatctcaaggtggag
gggctcaacccgaccggctcgttcaaggaccgcggcatgaccatggccgtcaccgaggcc
gtggcccgtgggcagaaggccgtgctgtgcgcgtcgacgggcaacacgtcggcctcggcg
gccgcctacgccgcacgggctggcatcacgtgtgcggtgctgattccgcagggcaagatc
gcgatgggcaagctcgcgcaggcggtcatgcacggcgcgaagatcattcaggtcgacggc
aacttcgacgactgcctcgagctggcccgcaagctcaccgccgactatccgacggtctcg
ctggtcaactccgtcaacccgtaccgcatcgagggacagaagaccgctgcgttcgagatc
gtcgacgcgcttggcaccgcgcctgatgtgcactcactgcccgtcggcaacgcgggcaac
atcaccgcgtattggaagggctacacggaataccaccgcgacggggtgtccgaccggctg
ccccgcatgctgggcacgcaggcagcgggagcggcgccgctggtgctgggggagccggtg
agccaccccgagaccatcgccaccgcgatccggatcggctcgcccgcgtcgtgggccacc
gcggtcgaggcgcagcagcagtccaacggccgattcctggccgccaccgacgaggagatc
ctcgccgcgtatcacctggtggcgcgcaccgaaggcgtgttcgtcgagccggcatcggcg
gccagcatcgcgggcctgctcaagtcgatcgaggacggctgggtgacgaaggggtcgacc
gtggtgtgcacggtgaccggcaacgggctcaaggatcccgacaccgcgctcaagggcatg
ccgtccgtcacgccggtgccggtcgatcccacggctgtcgtcgagaaactgggtttggtc
taa

DBGET integrated database retrieval system