KEGG   Mycobacterium smegmatis JS623: Mycsm_05018Help
Entry
Mycsm_05018       CDS       T02423                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mycsm_05018
Enzymes [BR:msa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Mycsm_05018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4967079..4967453
Genome map
AA seq 124 aa AA seqDB search
MTLSPDDVVTEFCQKWASPDPDELAGYFTEDAVYHNIPMDPVQGREAIKQFIAGFTAAFD
GIDFQVHRQISDGNVVMNERTDTMRRKGGGAIPLPVTGVFEVVDGKIAKWRDYFDMATVT
NAFA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacactctcccccgacgacgtggtgaccgaattctgccagaagtgggcctcgcctgat
ccggatgagctggccgggtacttcaccgaagacgccgtgtaccacaacattccgatggac
ccggtgcagggtcgcgaggcgatcaagcagttcatcgcgggcttcaccgccgcattcgac
ggaatcgatttccaggtgcatcggcagatcagcgacggcaacgtggtgatgaacgagcgg
accgacacgatgcgtcgcaagggcggcggcgcgataccactcccggtgacgggcgtcttc
gaggtcgtcgacggcaagatcgcgaagtggcgcgactacttcgacatggcgacggtcacc
aacgcattcgcctag

DBGET integrated database retrieval system