KEGG   Mycobacterium sp. JS623: Mycsm_05251Help
Entry
Mycsm_05251       CDS       T02423                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00040  Pentose and glucuronate interconversions
msa00052  Galactose metabolism
msa00500  Starch and sucrose metabolism
msa00520  Amino sugar and nucleotide sugar metabolism
msa01100  Metabolic pathways
msa01130  Biosynthesis of antibiotics
Module
msa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mycsm_05251
   00052 Galactose metabolism
    Mycsm_05251
   00500 Starch and sucrose metabolism
    Mycsm_05251
   00520 Amino sugar and nucleotide sugar metabolism
    Mycsm_05251
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mycsm_05251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75 IspD
Motif
Other DBs
NCBI-ProteinID: AGB25449
UniProt: L0J2C0
Position
complement(5208163..5209074)
Genome map
AA seq 303 aa AA seqDB search
MTRPEVPIPHTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLII
VTSEGKDSVVAHFVEDLVLEGTLEARGKTSMLEKVRRAPALIKVESVVQAEPLGLGHAVG
CVEGSLAPDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVDPTEISAYGVFD
VEKVPDTNNPNVLRVKGMVEKPKAEDAPSPYAAAGRYVLDRAIFDALKRVPHGAGGEIQL
TDAIALLIKEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALKRDDYGPELRRWLVERLGL
IDC
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacacggcctgaggtaccgattccgcacactgcggtcgtccccgcagcgggtttggga
acccggtttctgcccgcgaccaagacagtgccgaaggaattgctgcccgtcgtcgacacg
cccggcatcgaattggtggccgcggaggcggccgaagcgggtgccgaacggctgatcatc
gtcacctctgaaggcaaggacagcgttgtcgcccacttcgtcgaggacctggtgctcgag
gggacgctggaggcccgcggcaagacgtccatgctggagaaggtgcggcgcgcaccggcc
ctgatcaaggtcgagtcggtggtgcaggccgaaccccttggcctcgggcatgccgtcgga
tgcgtggaaggcagtctggcgcccgacgaagacgcgatcgcggtgctgctgcccgacgat
ctggtgttgccgaccggcgtgctggaaaccatgtcgaaggtgcgcgccaaacgcggcggc
tcggtgctgtgcgcaatcgaggtggatcccaccgagataagcgcctacggcgtgttcgac
gtcgagaaggtgccagataccaacaaccccaacgtgttacgcgtcaagggcatggtggag
aagccgaaggctgaagacgcaccgtcgccgtatgcggcagcgggacgctatgtgctggac
cgtgccatcttcgacgcgctcaagcgggttccgcatggcgccggcggcgagattcagttg
accgacgccatcgcgctgttgatcaaggagggacatccagtacacgtcgtcgtgcatcgc
gggtctcgacacgacctcggaaatcctggcggctatctcaaggctgcggttgactttgca
ttgaagcgcgacgactacggccccgagttgcggcggtggttggtggagcgattagggctg
atcgactgctga

DBGET integrated database retrieval system