KEGG   Mycobacterium smegmatis JS623: Mycsm_05251Help
Entry
Mycsm_05251       CDS       T02423                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mycsm_05251
   00052 Galactose metabolism
    Mycsm_05251
   00500 Starch and sucrose metabolism
    Mycsm_05251
   00520 Amino sugar and nucleotide sugar metabolism
    Mycsm_05251
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mycsm_05251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5208163..5209074)
Genome map
AA seq 303 aa AA seqDB search
MTRPEVPIPHTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLII
VTSEGKDSVVAHFVEDLVLEGTLEARGKTSMLEKVRRAPALIKVESVVQAEPLGLGHAVG
CVEGSLAPDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVDPTEISAYGVFD
VEKVPDTNNPNVLRVKGMVEKPKAEDAPSPYAAAGRYVLDRAIFDALKRVPHGAGGEIQL
TDAIALLIKEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALKRDDYGPELRRWLVERLGL
IDC
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacacggcctgaggtaccgattccgcacactgcggtcgtccccgcagcgggtttggga
acccggtttctgcccgcgaccaagacagtgccgaaggaattgctgcccgtcgtcgacacg
cccggcatcgaattggtggccgcggaggcggccgaagcgggtgccgaacggctgatcatc
gtcacctctgaaggcaaggacagcgttgtcgcccacttcgtcgaggacctggtgctcgag
gggacgctggaggcccgcggcaagacgtccatgctggagaaggtgcggcgcgcaccggcc
ctgatcaaggtcgagtcggtggtgcaggccgaaccccttggcctcgggcatgccgtcgga
tgcgtggaaggcagtctggcgcccgacgaagacgcgatcgcggtgctgctgcccgacgat
ctggtgttgccgaccggcgtgctggaaaccatgtcgaaggtgcgcgccaaacgcggcggc
tcggtgctgtgcgcaatcgaggtggatcccaccgagataagcgcctacggcgtgttcgac
gtcgagaaggtgccagataccaacaaccccaacgtgttacgcgtcaagggcatggtggag
aagccgaaggctgaagacgcaccgtcgccgtatgcggcagcgggacgctatgtgctggac
cgtgccatcttcgacgcgctcaagcgggttccgcatggcgccggcggcgagattcagttg
accgacgccatcgcgctgttgatcaaggagggacatccagtacacgtcgtcgtgcatcgc
gggtctcgacacgacctcggaaatcctggcggctatctcaaggctgcggttgactttgca
ttgaagcgcgacgactacggccccgagttgcggcggtggttggtggagcgattagggctg
atcgactgctga

DBGET integrated database retrieval system