KEGG   Mycobacterium smegmatis JS623: Mycsm_05277Help
Entry
Mycsm_05277       CDS       T02423                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mycsm_05277
Enzymes [BR:msa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mycsm_05277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5232101..5233483)
Genome map
AA seq 460 aa AA seqDB search
MTQPHDLPRTVGELKASGHRERGVKGEIRENLLAALAEGRDAWPGILGFEDTVIPQLERA
LIAGHDVVLLGERGQGKTRLLRALTGLLDDWTPVIAGAELNEHPYTPITPESIRRAAELG
DELPVAWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHRG
IVAINELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITP
LKDRFGAEIRTHYPLQLEAEVGVIKQESHLAAEVPEYLLHVLARFARHLRESHSIDQRSG
VSARFAIAAAETVAAAARHRSAVLGESEPVARVCDLGTVIDVLRGKLEFESGEEGREQAV
LEHLLRRATADTAQRLLGGIDVGPLVTAIEAGSAVTTGERVSARAVLDAVPEVPAIAQVQ
QRLGAHSDGERAAAVELALEALYLAKRIDKVSGEGETVYG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaacctcatgatctgccccggaccgtcggcgagctgaaagcctccggtcatcgc
gagcggggcgtcaaaggcgagatccgggagaacttgctggccgcgctggccgagggccgc
gacgcgtggcccggcatcctcggcttcgaagacaccgtgattccgcagctggagcgggcc
ctgatcgccggccacgacgtggtgctgctcggcgagcgcgggcaaggcaagacgcgcctg
ctgcgcgcactgaccgggctgctcgacgactggacgccggtgatcgcgggcgccgaattg
aacgagcatccatacacgccgatcacgccggagtcgatccgccgggccgccgagttaggc
gacgagctgcccgtcgcgtggcggcaccgcagtgagcggtacaccgagaagctggccacc
cccgacaccagcgtggccgacctggtcggtgacatcgacccgatcaaagtggccgagggc
cgcagccttggcgatccggagaccatcgcgtacggcctgattccacgggcgcaccgcggc
atcgttgccatcaacgagctgcccgaccttgccgagcgcattcaggtgtcgatgctgaat
gtgatggaggagcgcgacattcaggtgcgcggctatacgcttcggctgccgctcgacgtg
ctcgtcgtcgccagcgcgaaccccgaggactacaccaaccgcggccgcatcatcaccccg
ctcaaggaccggttcggcgccgagatccgcacccactatccgttgcaactcgaggcggaa
gtcggtgtgatcaaacaggagtcgcatctggctgcggaggtgcccgagtacctactgcat
gtgctcgcccgattcgccagacatcttcgcgagtcgcattcgatcgatcagcggtccggt
gtttcggcgcggttcgcgatcgcggctgcggagacggtcgccgccgcggcccggcaccgt
tcagccgtgctcggcgagtcggagccggtggcacgggtgtgcgacctcggcacggtcatc
gacgtgctgcgcggcaagttggagttcgaatccggcgaggagggccgcgagcaggccgtg
ctcgaacacctgctgcggcgcgccaccgcggacaccgcgcagcggctgcttggcggcatc
gacgtcggaccgttggtgaccgcgatcgaggccggttcggcggtcaccaccggtgaacgg
gtttcagccagagccgttttggatgcggtgccggaagtgcccgcgatcgcccaagttcag
cagcgcctcggtgcgcactccgatggtgaacgcgccgccgccgtcgaattggccttggag
gcactgtatctggccaagcgaatcgacaaggtcagcggcgaaggcgaaaccgtctatggc
tag

DBGET integrated database retrieval system