KEGG   Mycobacterium sp. JS623: Mycsm_05288Help
Entry
Mycsm_05288       CDS       T02423                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00020  Citrate cycle (TCA cycle)
msa00640  Propanoate metabolism
msa00660  C5-Branched dibasic acid metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01200  Carbon metabolism
Module
msa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycsm_05288
   00640 Propanoate metabolism
    Mycsm_05288
   00660 C5-Branched dibasic acid metabolism
    Mycsm_05288
Enzymes [BR:msa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mycsm_05288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGB25486
UniProt: L0J5E4
Position
complement(5244998..5246164)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAKAIAEEIGRPVMVKAQVKAGGRGKAGGVK
YAATPDDAFTHAQNILGLDIKGHIVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVEGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VAEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHVEFEDRDATDPLELKAKAN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDVQVKSVFVNVFGGITACDAVANGIVQALKILGDEANKPLVVRLDGNNVDEGRRIL
AEANHPLVTEVGTMDEAADVAAAKAASA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaagcgaaagagctgttcgcgaagcacaacgtgcccaccacg
ccgggtcgggtgaccgacaccgccgagggcgccaaggccatcgccgaagaaatcggccgg
cccgtcatggtcaaggcacaggtgaaggccggcggccgcggcaaggccggtggcgtgaaa
tatgcggccacccccgacgacgctttcacccacgcgcagaacatcctcggcctggacatc
aagggtcacatcgtgaagaagctgctggtcgccgaggccagcgacatcgccgaggagtac
tacatctcgttcctgctcgaccgcgccaaccgcacctacctggcgatgtgctcggtcgaa
ggtggcatggagatcgaagaggtcgcggcaaccaagcccgagcggctggccaaggtgccg
gtcaacgccgtcgagggcgtcgacctggcgttcgcgcggtcgatcgccgagcagggtcac
ctccccgcggaggtgctggacgcagcggccgtgacgatccagaagctgtgggaggtcttc
gtcgccgaggacgccacgctggtcgaggtgaacccattggtgcgtacgccggacgaccag
atcctcgcgctggacggcaaggtcacgctcgacgccaatgccgacttccgccagcccggc
cacgtcgagttcgaggaccgcgacgccaccgatccgctggaactcaaggccaaggcgaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgcgggcctg
gtgatgtccacgctcgacgtcgtcgcgtacgccggcgagaagcacggtggcgtgaagccg
gcgaacttcctcgacatcggcggcggcgcctcggccgaagtgatggccgcaggcctcgac
gtcatcctgaacgacgttcaggtcaagagcgttttcgtgaacgtgttcggcggcatcacc
gcgtgcgacgcggtcgccaacggcatcgttcaggcgctgaagatccttggcgatgaagcc
aacaagccactggtggtccggctcgacggcaacaacgtcgacgagggccgtcgcatcctg
gccgaggccaaccacccattggtgacggaggtcggcacgatggacgaggccgccgacgta
gccgctgccaaggccgcgagcgcctga

DBGET integrated database retrieval system