KEGG   Mycobacterium sp. JS623: Mycsm_05288Help
Entry
Mycsm_05288       CDS       T02423                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msa  Mycobacterium sp. JS623
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycsm_05288
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycsm_05288
   00640 Propanoate metabolism
    Mycsm_05288
   00660 C5-Branched dibasic acid metabolism
    Mycsm_05288
Enzymes [BR:msa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mycsm_05288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5244998..5246164)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAKAIAEEIGRPVMVKAQVKAGGRGKAGGVK
YAATPDDAFTHAQNILGLDIKGHIVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVEGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VAEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHVEFEDRDATDPLELKAKAN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDVQVKSVFVNVFGGITACDAVANGIVQALKILGDEANKPLVVRLDGNNVDEGRRIL
AEANHPLVTEVGTMDEAADVAAAKAASA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaagcgaaagagctgttcgcgaagcacaacgtgcccaccacg
ccgggtcgggtgaccgacaccgccgagggcgccaaggccatcgccgaagaaatcggccgg
cccgtcatggtcaaggcacaggtgaaggccggcggccgcggcaaggccggtggcgtgaaa
tatgcggccacccccgacgacgctttcacccacgcgcagaacatcctcggcctggacatc
aagggtcacatcgtgaagaagctgctggtcgccgaggccagcgacatcgccgaggagtac
tacatctcgttcctgctcgaccgcgccaaccgcacctacctggcgatgtgctcggtcgaa
ggtggcatggagatcgaagaggtcgcggcaaccaagcccgagcggctggccaaggtgccg
gtcaacgccgtcgagggcgtcgacctggcgttcgcgcggtcgatcgccgagcagggtcac
ctccccgcggaggtgctggacgcagcggccgtgacgatccagaagctgtgggaggtcttc
gtcgccgaggacgccacgctggtcgaggtgaacccattggtgcgtacgccggacgaccag
atcctcgcgctggacggcaaggtcacgctcgacgccaatgccgacttccgccagcccggc
cacgtcgagttcgaggaccgcgacgccaccgatccgctggaactcaaggccaaggcgaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgcgggcctg
gtgatgtccacgctcgacgtcgtcgcgtacgccggcgagaagcacggtggcgtgaagccg
gcgaacttcctcgacatcggcggcggcgcctcggccgaagtgatggccgcaggcctcgac
gtcatcctgaacgacgttcaggtcaagagcgttttcgtgaacgtgttcggcggcatcacc
gcgtgcgacgcggtcgccaacggcatcgttcaggcgctgaagatccttggcgatgaagcc
aacaagccactggtggtccggctcgacggcaacaacgtcgacgagggccgtcgcatcctg
gccgaggccaaccacccattggtgacggaggtcggcacgatggacgaggccgccgacgta
gccgctgccaaggccgcgagcgcctga

DBGET integrated database retrieval system