KEGG   Mycobacterium smegmatis JS623: Mycsm_05307Help
Entry
Mycsm_05307       CDS       T02423                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mycsm_05307
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mycsm_05307
Enzymes [BR:msa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mycsm_05307
Two-component system [BR:msa02022]
 CheA family
  CheA-CheYBV
   Mycsm_05307
Bacterial motility proteins [BR:msa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mycsm_05307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5264122..5265129
Genome map
AA seq 335 aa AA seqDB search
MASSAPRDAQASGVVAIGASAGGVEALTRLAAGLTSDLPFAVLMALHVPPGAPSVLGKIV
DRSGPLLAASAANGAPLESGRIHVAIPDRHLLVSRHRVVLSEGPTENGYRPAIDAMFRSV
ALEFGPRAIGVLMSGVLDDGVAGLGAIQARGGTTIVQQPDDALYPTMPQNAIDAGVADLQ
ATAAEVGAVLKRLADREIKERPMDPDINMELENRIAMGKRFEVSIEGDTLGPPSGYTCPD
CNGSLMTLSDTSYRCRVGHAWTADALLEARHDEVEGAVWVALRSLKEKANLSRRMAQKVG
PGTLFDRYNKVADEAERAMTVLGERLWDATGSRKG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctcagcgccacgagatgcgcaagcctcgggcgttgtcgcgatcggggcatct
gccggtggcgtcgaagccctgacgcggttggcagctggactgacttcggacctgccgttc
gcggtactaatggcactgcacgtgccgccaggtgcgccgagcgtcttaggcaaaatcgtc
gaccgcagcgggcccctgctggccgcttcggcggccaacggtgcaccgctcgagtccggt
cgcatccacgtcgccatccccgaccgccacctgctggtcagccgtcaccgagtggtgctg
tcggagggccccactgagaacggatatcggccggccatcgatgcgatgttccgttccgtc
gcgctggagttcggtccccgcgcgatcggagtgttgatgtccggcgtactggacgacggg
gttgcgggccttggcgccatccaggcgcgagggggaaccacgatcgtgcaacaacccgac
gacgcgctgtatcccaccatgccgcaaaacgcgatcgacgcgggtgtggccgatctgcag
gcgacggccgccgaggttggcgcggtcctgaagaggctggccgatcgagagatcaaggag
cgcccaatggaccccgacatcaacatggaactggagaaccgcatcgccatgggaaagcgg
ttcgaggtatcgattgagggcgacacgttgggcccgccgtcgggatatacgtgccccgat
tgcaacggctcgctgatgacgctgagcgatacgagctatcgctgccgagttgggcacgcc
tggaccgctgacgctttactcgaggcgaggcacgacgaagtcgagggcgcggtgtgggtg
gcccttcgaagcctgaaggagaaggcgaatctgtcccgccggatggcgcagaaagttggc
ccggggacacttttcgatcgatacaacaaagttgccgacgaagccgaacgagcgatgacc
gtgctcggggagcggctctgggacgcgacaggatcgcggaagggctga

DBGET integrated database retrieval system