KEGG   Mycobacterium sp. JS623: Mycsm_05309Help
Entry
Mycsm_05309       CDS       T02423                                 

Definition
(GenBank) PAS domain S-box
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa02020  Two-component system
msa02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mycsm_05309
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mycsm_05309
Enzymes [BR:msa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mycsm_05309
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mycsm_05309
Two-component system [BR:msa02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mycsm_05309
Bacterial motility proteins [BR:msa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mycsm_05309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheR_N PAS_10 PAS_9 PAS PAS_4 PAS_8 Spc7 PAS_7 Methyltransf_12 IncA OmpH DUF1664 DUF4795 Syntaxin-6_N HOOK JIP_LZII TMPIT Fez1 KxDL DUF4686 HIP1_clath_bdg HAUS-augmin3 WEMBL Mnd1 Tropomyosin UPF0449 Seryl_tRNA_N Atg14 Rootletin DUF3584 Jnk-SapK_ap_N IFT57 HMMR_N HemX TPR_MLP1_2 RPW8 WXG100 AAA_23 DUF3450 Exonuc_VII_L DUF724 ZapB Golgin_A5 DUF2203 GAS FapA APG6 APG17 CALCOCO1 Mt_ATP-synt_D ATG16 DUF5089 TMF_TATA_bd FliJ MCPsignal Mod_r EzrA zf-C4H2 ADIP LMBR1 DASH_Duo1 Tweety DUF3540 bZIP_1 CENP-F_leu_zip DUF4446 dCache_2 Snapin_Pallidin CENP-Q DivIC DUF812 Prefoldin_3 Neur_chan_memb Bap31 TBPIP Uds1 DUF16 Ax_dynein_light HALZ DUF3552 Fmp27_WPPW AAA_11 MCC-bdg_PDZ STAT_alpha DUF745 Reo_sigmaC Wtap V_ATPase_I DUF4618
Motif
Other DBs
NCBI-ProteinID: AGB25507
UniProt: L0J4H4
Position
5265934..5267775
Genome map
AA seq 613 aa AA seqDB search
MDERAGDEAFEALLRYMRDSRGFDFTGYKRSSLMRRVRHRMERLGADSFEQYLDTLQASA
DEFNDLFNTILINVTTFFRDPPAWEFLKSDVIPGVLAGSGPNDPIRVWSAGCASGEEAYS
LAMLLAEPLGAEAFSRRVKIYATDVDEHALAQARAASYEAKAVESVPKDLLESCFDRTAG
RYNIRKDLRRAVIFGRNDLVRDAPISRVDLLTCRNTLMYMNGETQRGVLNRLHYALSPRG
ILFLGHAEMLLSHSGRFTPINLEARMFRKASGSHGAVEKYGPSTALVRQGALSSLNSVRE
LAFHANPVPQIVLTSDDTVAMINEKAEQIFGLSARDIGRPLRDLDVSYRPLELRAQIKQV
KLNERPAMVPDVQWQRVSGDTGWYEVHLNPLTDADDAILGISIAFFDVTANKVLVDKVVD
AHKQLETAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQSTNDE
LHTINDELQSRSVELETARAFVDSLVDSIYLGMTVVDTEMRVLIWNRGCEELWGLRTEET
VGAMLSELDFGLPMDEVKHLIGKAFVDLDSFGETTVDAINRRGRSLRIRVSCTAFRDSSN
SINGAVLLMEAQN
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgagcaggcgacgaggctttcgaagctttattgcgctatatgcgcgattcc
cggggtttcgatttcacgggttacaagcgctcgtcgctgatgcgtcgggtgcgtcaccgg
atggagagactgggcgcggactcgttcgagcagtacctcgacactctgcaggcgagcgcg
gacgagttcaacgacctcttcaacacgatcttgatcaacgtgacgacgttctttcgcgat
ccgcccgcgtgggagtttctcaagagcgacgtcatacccggcgtgctcgccgggagcgga
ccgaacgatcccatccgcgtgtggagtgccggctgtgcctccggcgaggaagcctacagt
ctggcgatgctgctcgccgagccgctgggagccgaggcgttcagccgtcgagtcaagatc
tacgccactgatgtcgacgagcacgcccttgcgcaggcgcgggcggcgagttatgaagcc
aaagcggtcgagtctgttccgaaagacttgttggagagctgcttcgatcgcaccgcaggc
cgctacaacatccgtaaggacctgcgccgcgccgtcatcttcggccgcaatgacctggtc
agagacgcgcctatctcgcgggtcgacctgttgacgtgccggaacaccctgatgtacatg
aacggtgagacacagcgcggcgtgttgaaccgtctgcactacgcgctttccccccggggc
attctgtttctcggtcacgccgagatgctgctcagccattcgggccggttcaccccaatc
aacctggaagcaaggatgtttcggaaggcgtcgggttcacacggtgccgttgagaagtac
gggccctccaccgcgctggttcgtcagggcgcgctatctagtctgaactcggtgcgggag
ctcgcctttcacgccaatccagtgccgcagatcgtgctgaccagcgatgacacggtcgcg
atgatcaatgagaaagcagagcagatcttcggcttgtcggcccgcgacatcggtcgacca
ctgcgcgacctcgacgtctcctaccggccgttggagctgcgggcgcagatcaagcaggtg
aagctcaatgagcggcccgcaatggtgccggatgtgcaatggcaacgggtcagcggtgat
accggctggtatgaggttcacctcaatccgctgacggacgccgacgatgccattctcggc
atatcgatcgccttcttcgacgtgacggcgaacaaggtgctcgtcgacaaggtcgtcgac
gcccacaagcaactcgaaaccgcctacgaggaactgcaatccaccaacgaagagctcgag
acaaccaacgaggaattgcagtcgacggtcgaggaactggaaaccaccaacgaggaactg
caatccaccaacgaagagctcgagacgatgaacgaggagctgcagtcgacaaacgacgag
ctgcatacgatcaacgacgaattacagtcccgcagtgtcgaactcgagaccgcaagagca
ttcgtcgactccttggtcgactcgatctaccttggcatgacggtcgtcgacacggagatg
cgggtgctgatctggaatcgtggctgcgaagagttatggggcttgcggacggaggagacc
gtcggggcgatgctgtcggagctggacttcgggctgcccatggatgaggtcaagcacctg
ataggtaaggcgttcgtcgacctcgactcgttcggcgagacaaccgtcgacgcgatcaac
cggcgtgggcggtctttacggatccgcgtgtcctgcacggcttttcgcgattcctccaac
tcaatcaacggcgcagtgctgttgatggaggcgcagaactag

DBGET integrated database retrieval system