KEGG   Mycobacterium smegmatis JS623: Mycsm_05309Help
Entry
Mycsm_05309       CDS       T02423                                 

Definition
PAS domain S-box
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mycsm_05309
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mycsm_05309
Enzymes [BR:msa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mycsm_05309
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mycsm_05309
Two-component system [BR:msa02022]
 CheA family
  CheA-CheYBV
   Mycsm_05309
Bacterial motility proteins [BR:msa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mycsm_05309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5265934..5267775
Genome map
AA seq 613 aa AA seqDB search
MDERAGDEAFEALLRYMRDSRGFDFTGYKRSSLMRRVRHRMERLGADSFEQYLDTLQASA
DEFNDLFNTILINVTTFFRDPPAWEFLKSDVIPGVLAGSGPNDPIRVWSAGCASGEEAYS
LAMLLAEPLGAEAFSRRVKIYATDVDEHALAQARAASYEAKAVESVPKDLLESCFDRTAG
RYNIRKDLRRAVIFGRNDLVRDAPISRVDLLTCRNTLMYMNGETQRGVLNRLHYALSPRG
ILFLGHAEMLLSHSGRFTPINLEARMFRKASGSHGAVEKYGPSTALVRQGALSSLNSVRE
LAFHANPVPQIVLTSDDTVAMINEKAEQIFGLSARDIGRPLRDLDVSYRPLELRAQIKQV
KLNERPAMVPDVQWQRVSGDTGWYEVHLNPLTDADDAILGISIAFFDVTANKVLVDKVVD
AHKQLETAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQSTNDE
LHTINDELQSRSVELETARAFVDSLVDSIYLGMTVVDTEMRVLIWNRGCEELWGLRTEET
VGAMLSELDFGLPMDEVKHLIGKAFVDLDSFGETTVDAINRRGRSLRIRVSCTAFRDSSN
SINGAVLLMEAQN
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgagcaggcgacgaggctttcgaagctttattgcgctatatgcgcgattcc
cggggtttcgatttcacgggttacaagcgctcgtcgctgatgcgtcgggtgcgtcaccgg
atggagagactgggcgcggactcgttcgagcagtacctcgacactctgcaggcgagcgcg
gacgagttcaacgacctcttcaacacgatcttgatcaacgtgacgacgttctttcgcgat
ccgcccgcgtgggagtttctcaagagcgacgtcatacccggcgtgctcgccgggagcgga
ccgaacgatcccatccgcgtgtggagtgccggctgtgcctccggcgaggaagcctacagt
ctggcgatgctgctcgccgagccgctgggagccgaggcgttcagccgtcgagtcaagatc
tacgccactgatgtcgacgagcacgcccttgcgcaggcgcgggcggcgagttatgaagcc
aaagcggtcgagtctgttccgaaagacttgttggagagctgcttcgatcgcaccgcaggc
cgctacaacatccgtaaggacctgcgccgcgccgtcatcttcggccgcaatgacctggtc
agagacgcgcctatctcgcgggtcgacctgttgacgtgccggaacaccctgatgtacatg
aacggtgagacacagcgcggcgtgttgaaccgtctgcactacgcgctttccccccggggc
attctgtttctcggtcacgccgagatgctgctcagccattcgggccggttcaccccaatc
aacctggaagcaaggatgtttcggaaggcgtcgggttcacacggtgccgttgagaagtac
gggccctccaccgcgctggttcgtcagggcgcgctatctagtctgaactcggtgcgggag
ctcgcctttcacgccaatccagtgccgcagatcgtgctgaccagcgatgacacggtcgcg
atgatcaatgagaaagcagagcagatcttcggcttgtcggcccgcgacatcggtcgacca
ctgcgcgacctcgacgtctcctaccggccgttggagctgcgggcgcagatcaagcaggtg
aagctcaatgagcggcccgcaatggtgccggatgtgcaatggcaacgggtcagcggtgat
accggctggtatgaggttcacctcaatccgctgacggacgccgacgatgccattctcggc
atatcgatcgccttcttcgacgtgacggcgaacaaggtgctcgtcgacaaggtcgtcgac
gcccacaagcaactcgaaaccgcctacgaggaactgcaatccaccaacgaagagctcgag
acaaccaacgaggaattgcagtcgacggtcgaggaactggaaaccaccaacgaggaactg
caatccaccaacgaagagctcgagacgatgaacgaggagctgcagtcgacaaacgacgag
ctgcatacgatcaacgacgaattacagtcccgcagtgtcgaactcgagaccgcaagagca
ttcgtcgactccttggtcgactcgatctaccttggcatgacggtcgtcgacacggagatg
cgggtgctgatctggaatcgtggctgcgaagagttatggggcttgcggacggaggagacc
gtcggggcgatgctgtcggagctggacttcgggctgcccatggatgaggtcaagcacctg
ataggtaaggcgttcgtcgacctcgactcgttcggcgagacaaccgtcgacgcgatcaac
cggcgtgggcggtctttacggatccgcgtgtcctgcacggcttttcgcgattcctccaac
tcaatcaacggcgcagtgctgttgatggaggcgcagaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system