KEGG   Mycobacterium smegmatis JS623: Mycsm_05489Help
Entry
Mycsm_05489       CDS       T02423                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mycsm_05489
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mycsm_05489
   00600 Sphingolipid metabolism
    Mycsm_05489
Enzymes [BR:msa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Mycsm_05489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5444776..5446128
Genome map
AA seq 450 aa AA seqDB search
MSLASAGIAGCAAHIDAGAPQRLTPPMGWNSWNSGIPLTEDTVKATVDAMVSSGMRDAGY
RYVNLDAGWAAPTRGPDDKLRADPKTFPHGIAALARYVHDRGMLLGLYASPYDETCGQDP
RIASAGHEDTDARTFAAWGVDYLKYDWCHPDADHANQVKLFTAMRNALRATGRRIFYSIN
PNSSNNHHAGTGYDWSGIADMARNTTDLVPVWRNTLPPLDSSDAFLTGTYLGVPDEFRAS
SPVVSRSRAEYFNDPDMLVVGLSWSDFFVNHLDLSRILVSEDDLTPERLQKVRAKLALSN
AEVSWRANAQPSLTESEQRAHFSLWAMLAAPLLAGNDVRTMSDQTRAILTNRDVIAVDQD
PLTAQAKALPRDNRVLVKPLSDDAVAVALFNAADQPADITTSASIAGLRDAPCYAVRDLW
THTDTTTTGAIARTVAPHDVAMLRISPTCR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggcgagcgcgggcatcgccggctgcgccgcccacatcgatgcgggtgcaccg
cagcggctcacgccgccgatggggtggaactcgtggaactccggtatcccgctgaccgaa
gacacggtcaaggccaccgtcgacgcgatggtctcgtccggcatgcgcgacgcgggttac
cgctacgtcaacctcgacgcgggttgggcggcaccgacgcgcggacccgacgacaaactg
cgcgccgatccgaagacgtttccgcacggcatcgcggcattggctcgctacgtccatgac
cggggcatgctgctcggcctgtatgccagcccctacgacgagacctgcgggcaggatccc
cggatcgccagcgcaggccacgaggacaccgacgccaggacgttcgcagcgtggggcgtc
gactacctgaagtacgactggtgccaccccgatgcggaccacgccaatcaggtcaagctc
ttcactgcgatgcgaaatgcattgcgcgccaccggtcgtcgcatcttctacagcatcaat
ccgaacagttccaacaatcaccatgccggaacaggctacgactggtcgggcatcgccgac
atggcccgcaacaccaccgacctggttccggtgtggcgaaacacgctgccgccgttggac
agctccgacgcgttcctcaccggcacctatttgggcgtgcccgacgagtttcgcgcctcc
tcgccggtggtctcgcgaagccgcgcagagtatttcaatgaccccgacatgcttgtcgtg
ggattgtcgtggagtgacttcttcgtcaatcacctcgacctcagccgcattctcgtgtcg
gaggacgacctgacacccgagcgtctgcagaaggtgcgtgcgaagcttgcgctgtccaac
gccgaggtgtcgtggcgcgccaacgctcagcccagtttgaccgaatccgaacagcgcgcg
cacttttcgttgtgggcaatgctggcggcgccgctgctggcgggcaacgacgtccggacg
atgagcgatcagacgcgcgcgatcctgaccaaccgcgatgtgatcgctgtggaccaggac
ccattgaccgcgcaggcaaaggcgttaccgcgggacaacagagtcctggtgaagccgctg
tcggacgacgccgtggcggtcgcgctgttcaacgccgccgaccaacccgcagacatcacc
actagtgcatcgatcgccggactgcgcgacgcgccatgctacgcagtgcgcgacttgtgg
acgcacaccgacaccacgacgaccggcgcgatcgcccgcaccgtcgcgccacacgacgtc
gcgatgctgcggatctcgccgacctgtcgctga

DBGET integrated database retrieval system