KEGG   Mycobacterium smegmatis JS623: Mycsm_05489Help
Entry
Mycsm_05489       CDS       T02423                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:msa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:msa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:msa00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5444776..5446128
Genome map
AA seq 450 aa AA seqDB search
MSLASAGIAGCAAHIDAGAPQRLTPPMGWNSWNSGIPLTEDTVKATVDAMVSSGMRDAGY
RYVNLDAGWAAPTRGPDDKLRADPKTFPHGIAALARYVHDRGMLLGLYASPYDETCGQDP
RIASAGHEDTDARTFAAWGVDYLKYDWCHPDADHANQVKLFTAMRNALRATGRRIFYSIN
PNSSNNHHAGTGYDWSGIADMARNTTDLVPVWRNTLPPLDSSDAFLTGTYLGVPDEFRAS
SPVVSRSRAEYFNDPDMLVVGLSWSDFFVNHLDLSRILVSEDDLTPERLQKVRAKLALSN
AEVSWRANAQPSLTESEQRAHFSLWAMLAAPLLAGNDVRTMSDQTRAILTNRDVIAVDQD
PLTAQAKALPRDNRVLVKPLSDDAVAVALFNAADQPADITTSASIAGLRDAPCYAVRDLW
THTDTTTTGAIARTVAPHDVAMLRISPTCR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggcgagcgcgggcatcgccggctgcgccgcccacatcgatgcgggtgcaccg
cagcggctcacgccgccgatggggtggaactcgtggaactccggtatcccgctgaccgaa
gacacggtcaaggccaccgtcgacgcgatggtctcgtccggcatgcgcgacgcgggttac
cgctacgtcaacctcgacgcgggttgggcggcaccgacgcgcggacccgacgacaaactg
cgcgccgatccgaagacgtttccgcacggcatcgcggcattggctcgctacgtccatgac
cggggcatgctgctcggcctgtatgccagcccctacgacgagacctgcgggcaggatccc
cggatcgccagcgcaggccacgaggacaccgacgccaggacgttcgcagcgtggggcgtc
gactacctgaagtacgactggtgccaccccgatgcggaccacgccaatcaggtcaagctc
ttcactgcgatgcgaaatgcattgcgcgccaccggtcgtcgcatcttctacagcatcaat
ccgaacagttccaacaatcaccatgccggaacaggctacgactggtcgggcatcgccgac
atggcccgcaacaccaccgacctggttccggtgtggcgaaacacgctgccgccgttggac
agctccgacgcgttcctcaccggcacctatttgggcgtgcccgacgagtttcgcgcctcc
tcgccggtggtctcgcgaagccgcgcagagtatttcaatgaccccgacatgcttgtcgtg
ggattgtcgtggagtgacttcttcgtcaatcacctcgacctcagccgcattctcgtgtcg
gaggacgacctgacacccgagcgtctgcagaaggtgcgtgcgaagcttgcgctgtccaac
gccgaggtgtcgtggcgcgccaacgctcagcccagtttgaccgaatccgaacagcgcgcg
cacttttcgttgtgggcaatgctggcggcgccgctgctggcgggcaacgacgtccggacg
atgagcgatcagacgcgcgcgatcctgaccaaccgcgatgtgatcgctgtggaccaggac
ccattgaccgcgcaggcaaaggcgttaccgcgggacaacagagtcctggtgaagccgctg
tcggacgacgccgtggcggtcgcgctgttcaacgccgccgaccaacccgcagacatcacc
actagtgcatcgatcgccggactgcgcgacgcgccatgctacgcagtgcgcgacttgtgg
acgcacaccgacaccacgacgaccggcgcgatcgcccgcaccgtcgcgccacacgacgtc
gcgatgctgcggatctcgccgacctgtcgctga

DBGET integrated database retrieval system