KEGG   Mycobacterium sp. JS623: Mycsm_05772Help
Entry
Mycsm_05772       CDS       T02423                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00360  Phenylalanine metabolism
msa00362  Benzoate degradation
msa00620  Pyruvate metabolism
msa00621  Dioxin degradation
msa00622  Xylene degradation
msa00650  Butanoate metabolism
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
msa01220  Degradation of aromatic compounds
Module
msa_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycsm_05772
   00650 Butanoate metabolism
    Mycsm_05772
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mycsm_05772
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycsm_05772
   00622 Xylene degradation
    Mycsm_05772
   00621 Dioxin degradation
    Mycsm_05772
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mycsm_05772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGB25946
UniProt: L0J6M1
Position
complement(5723999..5724913)
Genome map
AA seq 304 aa AA seqDB search
MARKASVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLAQSDKPDLVFEATSAYVHRDAAPKYAEAGIRAVDLTPAAVGPGVIPPANLRQHLDAP
NVNMVTCGGQATIPIVYAVSRVVDVPYGEIVASVSSASAGPGTRANIDEFTKTTSAGVQD
IGGAKRGKAIIILNPAEPPMIMRDTIFCAIPEDADHDAITQSIKDVVAEVQTYVPGYRLL
NEPQFDEPSVVNGGNHLVTTFIEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLAVA
GGQA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaaggcctctgtcgcgatcgtcgggtcgggcaacatcagcaccgacctgctg
tacaaactgctgcgctcagagtggctggagccgcgctggatgatcggcattgacccggag
tccgaggggctggcccgcgcacgcaagctcgggctggagacgtcacacgaaggcgtcgat
tggctgctcgcgcaaagcgacaagccggatctcgttttcgaggcgaccagcgcctacgtc
caccgcgacgcggcgcccaagtatgcagaagccggaatccgcgcggtcgacctgacacct
gccgccgtcgggcccggcgtgattccgcccgccaatctgcggcagcacctggatgcgccg
aacgtcaacatggtgacctgtggtgggcaggccacgattccgatcgtgtatgcggtctcg
cgtgtcgtcgacgtgccgtacggcgagatcgtggcgtcggtgtcgtcggcgtctgccgga
ccgggcacccgggccaacatcgacgagttcaccaagaccaccagcgcgggtgtgcaggac
atcggcggcgccaagcggggcaaggcgatcatcatcctcaacccggccgaaccgccaatg
atcatgcgcgacaccatcttctgcgccattcccgaggacgccgaccacgacgcgatcacc
cagtcgatcaaggacgtcgtcgccgaagtgcagacctacgttcctggctaccggctgctc
aacgagccccagttcgacgagccgtcggtggtcaacggtggcaatcacctggtcacgacg
ttcatcgaggtcgagggcgccggggactacctgccgccgtatgcgggaaatctggacatc
atgaccgcggcggccaccaaggtcggcgaggaaatcgccaaagagtcgctcgcagtagct
ggaggccaggcatga

DBGET integrated database retrieval system