KEGG   Mycobacterium smegmatis JS623: Mycsm_05772Help
Entry
Mycsm_05772       CDS       T02423                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mycsm_05772
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycsm_05772
   00650 Butanoate metabolism
    Mycsm_05772
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mycsm_05772
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycsm_05772
   00622 Xylene degradation
    Mycsm_05772
   00621 Dioxin degradation
    Mycsm_05772
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mycsm_05772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5723999..5724913)
Genome map
AA seq 304 aa AA seqDB search
MARKASVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLAQSDKPDLVFEATSAYVHRDAAPKYAEAGIRAVDLTPAAVGPGVIPPANLRQHLDAP
NVNMVTCGGQATIPIVYAVSRVVDVPYGEIVASVSSASAGPGTRANIDEFTKTTSAGVQD
IGGAKRGKAIIILNPAEPPMIMRDTIFCAIPEDADHDAITQSIKDVVAEVQTYVPGYRLL
NEPQFDEPSVVNGGNHLVTTFIEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLAVA
GGQA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaaggcctctgtcgcgatcgtcgggtcgggcaacatcagcaccgacctgctg
tacaaactgctgcgctcagagtggctggagccgcgctggatgatcggcattgacccggag
tccgaggggctggcccgcgcacgcaagctcgggctggagacgtcacacgaaggcgtcgat
tggctgctcgcgcaaagcgacaagccggatctcgttttcgaggcgaccagcgcctacgtc
caccgcgacgcggcgcccaagtatgcagaagccggaatccgcgcggtcgacctgacacct
gccgccgtcgggcccggcgtgattccgcccgccaatctgcggcagcacctggatgcgccg
aacgtcaacatggtgacctgtggtgggcaggccacgattccgatcgtgtatgcggtctcg
cgtgtcgtcgacgtgccgtacggcgagatcgtggcgtcggtgtcgtcggcgtctgccgga
ccgggcacccgggccaacatcgacgagttcaccaagaccaccagcgcgggtgtgcaggac
atcggcggcgccaagcggggcaaggcgatcatcatcctcaacccggccgaaccgccaatg
atcatgcgcgacaccatcttctgcgccattcccgaggacgccgaccacgacgcgatcacc
cagtcgatcaaggacgtcgtcgccgaagtgcagacctacgttcctggctaccggctgctc
aacgagccccagttcgacgagccgtcggtggtcaacggtggcaatcacctggtcacgacg
ttcatcgaggtcgagggcgccggggactacctgccgccgtatgcgggaaatctggacatc
atgaccgcggcggccaccaaggtcggcgaggaaatcgccaaagagtcgctcgcagtagct
ggaggccaggcatga

DBGET integrated database retrieval system