KEGG   Mycobacterium smegmatis JS623: Mycsm_05924Help
Entry
Mycsm_05924       CDS       T02423                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5886583..5887197)
Genome map
AA seq 204 aa AA seqDB search
MTMTRPHNNSATFTSPVFDQPRAEAAVRELLIAIGENPDRHGLEDTPARVARAYKELFAG
LYTDPDTVLDTTFDEQHDELVLVKQIPMYSTCEHHLVSFHGLAHVGYIPGKDGRVTGLSK
IARLVDLYAKRPQVQERLTAQIADALMRKLDPRGVIVVIEAEHLCMAMRGVRKPGAITTT
SAVRGQFKCDAASRAEALDLILRK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgcggccgcacaacaactcggccacgttcaccagcccggtgttcgaccaa
ccgcgtgccgaggccgcggttcgcgaactgctgatcgcgatcggggagaaccccgaccgg
cacgggctggaggacactcccgctcgcgtggcgcgggcatacaaggagctgttcgccggt
ctctacaccgatccggataccgtgctggacaccacctttgacgagcagcacgacgaattg
gtgttggtcaagcagatcccgatgtactcgacctgcgagcaccatctggtgtcgttccac
ggcctcgcgcacgtcggctacattcccggcaaggacggccgcgtcaccgggctctcgaag
atcgcccggctcgtcgacttgtacgccaaacgcccgcaggtgcaagagcggctcactgca
cagatcgccgatgcgctgatgcgcaaactcgatccgcgcggtgtgatcgtcgtcatcgag
gccgaacacctttgcatggcaatgcgcggcgtgcgtaaacccggcgccatcaccaccacg
tcggcggtgcgtggccagttcaaatgcgatgcggcatcgcgtgccgaggcgctggatctg
atcctgcgaaagtga

DBGET integrated database retrieval system