KEGG   Mycobacterium smegmatis JS623: Mycsm_06022Help
Entry
Mycsm_06022       CDS       T02423                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mycsm_06022
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mycsm_06022
Exosome [BR:msa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mycsm_06022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5986285..5987802)
Genome map
AA seq 505 aa AA seqDB search
MAEFVAAVDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPKAGWVEHNPVEIWERTASVIQ
SALNRTKLSVTDLAALGITNQRETALVWNRRTGRPYHNAIVWQDTRTDRIASALDRDGRG
DVIRRKAGLPPATYFSAGKVQWILENVDGVRADAEEGDVLFGTPDTWVLWNLTGGPRGGV
HVTDVTNASRTMLMNLETLDWDDELLSFFGIPRQMLPEIKPSSFPESYGITRDDGPVGGH
VPITGILGDQQAAMVGQVCLDAGEAKNTYGTGNFLLINTGEKIVRSENGLLTTVCYQFGD
AKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSEALARQVEDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVHLEVLKVDGGITAN
DLCMQIQADVLGVDVVKPVVAETTALGAAYAAGLAVGFWENPDDLRANWQEDKRWSPAWT
EDQRNSGYAGWQKAVQRTLDWVDVD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagttcgtagcggccgtggaccagggcaccaccagcacaaggtgcatgattttc
gaccacgacggcgctgaggtggggcgccaccagctcgaacacgaacagatcctgccgaag
gccggctgggtcgagcacaacccggtggagatctgggaacgcaccgcctcggtgatccag
tcggccctgaacagaacgaagctgtcggtgaccgacctggccgcgctgggcatcaccaac
cagcgcgaaaccgcgctggtatggaaccgtcgcaccgggcggccgtatcacaacgcgatc
gtctggcaggacacccgcaccgaccgcattgcctccgcgctcgaccgcgacggccgcggc
gacgtgatccggcgcaaggccggcctgccgcccgccacgtatttctcggcgggcaaggtg
caatggattctggagaacgtcgacggtgtgcgcgccgatgctgaggagggtgacgtgctg
ttcggcaccccggacacctgggtgctgtggaatctgaccggcggcccgcgtggcggcgtc
cacgtcaccgacgtgacgaacgccagccggaccatgctgatgaatctggagacgctcgac
tgggacgacgagctgctgtccttcttcgggattccgcggcagatgctgcccgaaatcaag
ccgtcgtcgtttcccgagtcgtacggcatcacccgcgatgacggcccagtcggcgggcat
gtcccgatcaccggaatcctcggcgatcagcaggccgcgatggtcgggcaggtgtgtctg
gacgccggcgaggccaaaaacacctacggcacaggcaatttcctgctgatcaacaccggt
gaaaagattgttcgttccgagaacgggctactgaccacggtctgctatcagttcggcgac
gccaaacccgtttacgcactggagggttcgatcgcggtcaccggctcagcggtgcagtgg
ctgcgcgaccagttgggcatcatcagtggcgccgcgcagagtgaggcgctggcccgccag
gtcgaagacaacggtggcgtgtacttcgtccctgcgttctcgggattgtttgcaccgtac
tggcgttcggatgcgcgaggcgccatcgtcggcctgtcgcgctttaacaccaatgcacat
ctggcacgcgcgactttggaggcgatctgctaccagagccgcgacgtggtcgacgcgatg
gaggccgattccggtgtgcaccttgaagttttgaaggtcgacggaggtatcaccgccaac
gatctctgcatgcagattcaggccgacgtgctcggcgtcgacgtggtcaagcctgtcgtc
gccgagacgacggcgctgggcgcggcatacgcggcaggcctggcggtgggattctgggaa
aaccccgacgaccttcgcgcgaactggcaggaggacaagcgctggtcgcccgcgtggacc
gaagaccagcgcaactccggttacgccggatggcagaaagccgtgcagcggacattggac
tgggtcgacgtcgactga

DBGET integrated database retrieval system