KEGG   Mycobacterium smegmatis JS623: Mycsm_06059Help
Entry
Mycsm_06059       CDS       T02423                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mycsm_06059
DNA repair and recombination proteins [BR:msa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mycsm_06059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6022832..6023431)
Genome map
AA seq 199 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNKVRDGVKFCAVCG
NVSDEDRCRICSDARRDPAVVCVVEEPKDVQAVERTREFRGTYHVLGGALDPLSGIGPEQ
LRIRELLNRLGETEISEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDL
EFADELTLGRALAGRRAMA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaaggccctgtccaggatttgatcgacgagctcggcaagctgcccggcatcggg
ccgaagagtgcgcagcggatcgcattccacctgctgtcggtggagccgcccgacatcgac
cggctgaccgcggtgttgaacaaggttcgcgacggcgtgaagttttgcgcggtatgcgga
aatgtctccgacgaggaccgctgtcggatttgttctgatgcgcgacgtgatcccgctgtg
gtgtgtgtcgtcgaggagccgaaggatgtgcaggccgtcgagcgcacccgcgaattccgc
ggcacctaccacgttttgggtggggcgttggacccgctgtctggcattgggccagaacaa
cttcggattcgtgagctgttgaaccgcctcggtgaaaccgagatttccgaggtgatcatc
gcgacggatccgaacaccgagggtgaggcgaccgcgacatacttggtgcggatgctgcgc
gatatcccgggtttgacggtgacgcgcattgcgtcgggcctgccgatgggcggcgacctg
gagttcgccgacgagctgacgctgggccgggccctggcgggccgccgcgcaatggcctga

DBGET integrated database retrieval system