KEGG   Mycobacterium sp. JS623: Mycsm_06071Help
Entry
Mycsm_06071       CDS       T02423                                 

Definition
(GenBank) putative dihydrodipicolinate reductase-like protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: AGB26232
UniProt: L0J6J1
Position
6033442..6034512
Genome map
AA seq 356 aa AA seqDB search
MLNTTPHRVVQWTTGNVGKSSVAAIAANPTLDLIGCYAWSTDKVGRDVGELAGIQPLGVT
ATNDVDALLALKPDCVVYNPMWIDVDELVRILSAGVNVVASASFITGRNLGDDRAKLEDA
CQKGGSTLFGSGVSPGFAELLAIVAATSCDRVDKITIAESADTTLYDSPDTERPCGFGMP
IDDPDLQPMMSKGTAVFAEAVQLVADSLGVELDEIKCVAEYAQSTSDVTMASWTIPAGHV
AGVFASWQGIVNGKTVIDINVRWKKGHTLEPDWKLDADGWKITIDGRPTVNMQVGFLPPQ
DMIENAKSIEDFFVLGKIMTAMPPIHAIPAVVAAPPGIVTYNDLPLPQAKGVVPQG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaacaccactcctcatcgcgttgtccagtggacgacgggaaacgtcggcaaaagc
tccgtagcggccatcgctgccaaccccacacttgacctcatcggctgttacgcgtggtcg
acggacaaagtcggccgcgacgtcggagagctggccggcatccagccgctcggcgtcacg
gccaccaatgacgtcgatgcgctgctggcactcaagcccgactgcgtcgtctacaacccg
atgtggatcgacgtcgacgagctcgtccgcatcctttcggcgggcgtcaacgtcgtcgcc
tctgcgtccttcatcaccggccgcaatctcggggacgacagagccaaactcgaagatgct
tgccagaagggcggatcgacgctcttcggctccggcgtgagtcccggattcgcagagttg
ctcgcgattgtcgcggcgacatcctgcgatcgcgtcgacaagatcaccatcgcggagtct
gccgacaccaccctctacgactcacccgacaccgagcgaccgtgtggcttcggcatgccc
attgacgatcccgacctgcagccgatgatgtcgaagggcaccgcggtgttcgccgaggcg
gtacagctggtcgccgactcactcggggtcgaactcgacgagatcaagtgtgtggccgaa
tacgcccagagcacttcggacgtcaccatggcgtcatggaccattcccgcgggccacgtg
gcgggcgtcttcgccagctggcagggaattgtcaacggcaagaccgtcatcgacatcaac
gtccggtggaagaagggccacacgctcgaaccggactggaagctggacgccgatggttgg
aagatcacgatcgacggccgtccgactgtcaacatgcaggtcggctttcttccgccacag
gacatgatcgagaacgcgaagtcgattgaggacttcttcgtcctcgggaaaatcatgacg
gcgatgccgccgatccacgccatccccgccgtggttgccgcgccgccgggcatcgtgacc
tacaacgacctgccactgccacaggcgaaaggcgttgtgccgcagggctag

DBGET integrated database retrieval system