KEGG   Mycobacterium sp. JS623: Mycsm_06089Help
Entry
Mycsm_06089       CDS       T02423                                 

Definition
(GenBank) amino acid ABC transporter ATP-binding protein, PAAT family
  KO
K10010  
cystine transport system ATP-binding protein [EC:3.6.3.-]
Organism
msa  Mycobacterium sp. JS623
Pathway
ABC transporters
Module
Cystine transport system
Brite
KEGG Orthology (KO) [BR:msa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mycsm_06089
Enzymes [BR:msa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Mycsm_06089
Transporters [BR:msa02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    Mycsm_06089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6050311..6051066
Genome map
AA seq 251 aa AA seqDB search
MTENRVLAEGVHKAFGENEVLKGVSFTVPQGSATTIIGPSGSGKTTLLRALNALDVPDAG
VIRVGEVELDFSKPVAKDQLRRYRAQSGFVFQSHNLFPHKTVLQNITEGPIFVQKRPKDE
AEAEAAELLQQVGLAEKRDQYPYQLSGGQQQRVGIARALALKPKVVLFDEPTSALDPELV
GEVLSVIRDLAVEGWTLVIVTHEIQFAKQVSDQVLFTDHGVILEQGPPAEVIGNPKEERT
RQFLDRILNPL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaaccgcgtgctggccgagggcgtgcacaaggccttcggggaaaatgaagtg
ctcaaaggtgtttcgttcacggtgccgcagggctcggcgacgacgatcatcgggccttcg
ggctcggggaagacgacgctgctgcgggcgctcaacgcattggacgtgcctgatgcaggg
gtgatccgcgtcggcgaggtcgaactggacttctccaagccggtggccaaagaccagctg
cgtcggtatcgcgcgcagagcggctttgtcttccagtcgcacaacctgtttccgcacaag
acggtgttgcagaacatcaccgagggcccgatcttcgtgcagaaacggccgaaggacgag
gcggaagccgaagccgccgaactgctgcagcaggtcggcctcgccgaaaagcgggaccag
tacccgtatcaactgtccggtggccagcagcagcgtgtcggcatcgccagggcgctggcg
ctgaagcccaaggtggtgctattcgacgagccaacgtcggcgctggatcccgaactcgtc
ggtgaggtgctgtccgtcatcagggatctggccgtcgagggctggacgttggtgatcgtg
acgcacgaaatccagttcgccaagcaggtttccgatcaggtgctgttcaccgatcacggg
gtgattctggagcagggtccgcccgccgaggtgatcggcaaccccaaggaagagcgcacc
cgccagttcctggaccggatcctcaacccgctgtag

DBGET integrated database retrieval system