KEGG   Mycobacterium sp. JS623: Mycsm_06110Help
Entry
Mycsm_06110       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26269
UniProt: L0J4Q2
Position
complement(6075173..6076915)
Genome map
AA seq 580 aa AA seqDB search
MIRASRAQNEYRLVVVTGTSGLGLDNAGRRLAESLGSDWSHFAFESYLLAAESDVLGLDT
TNNKTLIEFLLGSEPLLEAVWSRAFQTVDSILVDSLKQKNVVLTMHTSWWAPGSTTITPC
VNYKLVANARWVPDVVVNLIDDIYDIYYRLSGVGQIFYPYDALALSDEIRTLQRLLDWRL
VEFRSTKALATAVSGDTRCPVYLVSVKHPLATLVKLIEGDHRCVYLSHPISEVRRKGVAP
EDATLNAVQRVSSLLRREFVLFEPTTIDEYRFRIEDEADDDVPASPSRASLTRRWPALLD
LDGSDEQCVTPTPEAFRMLSIETGVEGVRNVSLVKELVRKIDEQINWRDRQLVIQSESLA
VITPFSKLDGTVSGGVREEVDLHAKLCGYKELPSVVAVQGRFSGVIYHPKDDERNRGLKA
IAAVLIDNLERIPPAGSTLVLDDVLSTAEMLAETLAFATVTDLKRYADSNDLTSQTVTAL
EDICGIRVRVPNSMPRPDAQNLSYPKWLGIQQVNERKFSRKLVQAFLGYGDEFNLQYELE
RRTPWAEENEEHFQVIQDPMQPDELANALTETLIGIAGST
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgcgtcccgtgcacagaacgaatatcgccttgtcgttgttacgggaacaagt
gggcttggtttagacaacgcaggtcggcggctcgcagagagcctcggaagcgactggtcg
catttcgcgttcgagagctatctcctcgcggcggaatcagatgtgctcgggctcgatacc
acgaacaacaaaactctgattgaatttcttctcggtagtgaaccactattagaagcagtg
tggtccagggctttccagacagtcgactccatccttgtggattctctcaagcaaaaaaac
gtcgtacttaccatgcatacatcgtggtgggcgcccgggagtacgactatcacgccatgc
gtcaactacaagcttgtcgcgaacgcacgctgggtgccagacgtggtcgtcaacctcatt
gacgacatctatgacatttactatcgcctgagcggtgtcggacagattttctacccatac
gatgccctcgcactttccgatgaaattcggacattgcaaaggctgcttgactggcgccta
gtggagttccgtagtacgaaggctctagccacggctgtatcaggggatacgcgctgtccc
gtctatcttgtgtctgtcaaacacccattggccaccctagtgaagttgattgagggcgat
caccgttgtgtttatctctcacacccaatcagtgaggtgcggcgcaaaggagtagcgccg
gaggatgcgacattaaacgccgtacaacgagtctcgtcgttgttacgtcgcgagtttgta
ctcttcgaacccacgacgatcgacgagtatcgtttcaggatcgaagatgaggcagacgac
gatgtgccggcgagcccgagtcgtgcgagcctgacaaggaggtggccagctctcctggac
ctggatggctcagatgagcaatgcgttacacccactcccgaggcctttcgaatgttgtca
atcgagaccggtgtcgagggggttcgaaacgtatcccttgtaaaggaattggttcgtaag
attgacgagcagattaattggcgcgaccgccagttggtgattcaatctgagtcgctcgcc
gtcatcacacccttctcgaaactagacggcactgtatcgggcggtgtacgcgaggaggta
gatttgcacgctaagctatgtgggtacaaagaattgcctagtgttgtggctgttcaggga
cgattcagtggcgtgatctatcatcctaaagatgatgagcgcaatcgcgggcttaaagca
attgctgcggttcttatcgataatcttgaacggatcccacctgcagggagcaccctggtg
ctcgatgatgttctaagcactgctgagatgctggcagagaccctcgcatttgcgacagtc
accgacttgaaaaggtacgcagactccaatgacctcacgagtcagacggttacagcccta
gaagacatctgtgggatccgcgtaagagtgccgaacagcatgccgaggccagatgcgcag
aatctgagttacccgaagtggttggggatccaacaggttaacgagcgaaaattcagtagg
aagttggttcaagccttcttgggctacggagacgaatttaacctccagtacgaactggag
cggcgaacgccttgggccgaggaaaacgaggagcactttcaggtcatccaggacccgatg
cagccggacgaactggcaaatgcgttgactgagacgctcatcggcatagctggcagcacc
tag

DBGET integrated database retrieval system