KEGG   Mycobacterium sp. JS623: Mycsm_06114Help
Entry
Mycsm_06114       CDS       T02423                                 

Definition
(GenBank) Protein of unknown function (DUF732)
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF732
Motif
Other DBs
NCBI-ProteinID: AGB26273
UniProt: L0J5Y0
Position
6078162..6078530
Genome map
AA seq 122 aa AA seqDB search
MIDVPKHLGKRTKLVTVLVALTAPLILAPAARADTGIFTQAEAQYLEQLAGQGILPQTLG
MTNGRDEVGLGHGICLALNDHSHDVVDAGIKRNWSNLSQLQINALVGFAVADFCEQNASK
LS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacgtccccaagcacctaggtaaacggacgaaactcgtcaccgtcctagtggcc
ctgaccgcacccctcatcctggcaccggccgcacgagcagacactgggatcttcacccag
gctgaggcccagtacctggagcagcttgccggacagggcatcctgccgcagacgctcggg
atgaccaacggccgagatgaggttgggctgggccatggcatctgccttgccctcaatgac
cacagccacgatgtcgtggatgcgggtatcaagcgcaactggtcgaacctcagccagcta
caaatcaatgcgctcgtcgggttcgccgtggccgacttctgtgagcagaacgcgagcaag
ttgtcatga

DBGET integrated database retrieval system