KEGG   Mycobacterium sp. JS623: Mycsm_06122Help
Entry
Mycsm_06122       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26281
UniProt: L0J7K3
Position
complement(6081069..6081209)
Genome map
AA seq 46 aa AA seqDB search
MSAERGWIGEPQPERQWHNSHYSREADRIAVRDRGTVPITDDEAHD
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgagcgtggatggatcggtgagccacaaccagagagacagtggcataactcc
cactactcacgggaggccgacaggattgccgtccgcgatcgcgggacggtcccaatcacc
gatgacgaagcgcatgactga

DBGET integrated database retrieval system