KEGG   Mycobacterium sp. JS623: Mycsm_06123Help
Entry
Mycsm_06123       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6081206..6081412)
Genome map
AA seq 68 aa AA seqDB search
MAELDLVRLRELAAELGYWPASTDEEHVARLRAQDARYDEQVAQDPDGAKWQKMMGVPSY
RRNQRTQS
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctggacttggtcaggctgcgtgagttggcggccgaactcggctactggcct
gcctccaccgacgaggagcacgtcgcccgtctgcgtgcccaggacgcccgctatgacgag
caggtggcccaggaccccgacggcgccaagtggcagaaaatgatgggtgtccccagttat
cggagaaatcaaaggacacagtcatga

DBGET integrated database retrieval system